1. Recombinant Proteins
  2. Others
  3. HIN-1/SCGB3A1 Protein, Human (HEK293, Fc)

HIN-1/SCGB3A1, a secreted cytokine-like protein, inhibits in vitro cell growth. Structurally, it forms a homodimer held together by disulfide bonds, emphasizing its functional arrangement. HIN-1/SCGB3A1 Protein, Human (HEK293, Fc) is the recombinant human-derived HIN-1/SCGB3A1 protein, expressed by HEK293 , with C-mFc labeled tag. The total length of HIN-1/SCGB3A1 Protein, Human (HEK293, Fc) is 84 a.a., with molecular weight of 38 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HIN-1/SCGB3A1, a secreted cytokine-like protein, inhibits in vitro cell growth. Structurally, it forms a homodimer held together by disulfide bonds, emphasizing its functional arrangement. HIN-1/SCGB3A1 Protein, Human (HEK293, Fc) is the recombinant human-derived HIN-1/SCGB3A1 protein, expressed by HEK293 , with C-mFc labeled tag. The total length of HIN-1/SCGB3A1 Protein, Human (HEK293, Fc) is 84 a.a., with molecular weight of 38 kDa.

Background

HIN-1/SCGB3A1 is a secreted cytokine-like protein known for its role in inhibiting cell growth in vitro. This protein exists as a homodimer, connected by disulfide bonds, highlighting its structural arrangement as it carries out its function.

Species

Human

Source

HEK293

Tag

C-mFc

Accession

Q96QR1/NP_443095.2 (F21-G104)

Gene ID
Molecular Construction
N-term
HIN-1 (F21-G104)
Accession # Q96QR1/NP_443095.2
mFc
C-term
Synonyms
Secretoglobin family 3A member 1; HIN1; PNSP2; UGRP2
AA Sequence

FLVGSAKPVAQPVAALESAAEAGAGTLANPLGTLNPLKLLLSSLGIPVNHLIEGSQKCVAELGPQAVGAVKALKALLGALTVFG

Molecular Weight

Approximately 38 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

HIN-1/SCGB3A1 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HIN-1/SCGB3A1 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P77192
Quantity:
MCE Japan Authorized Agent: