1. Recombinant Proteins
  2. Others
  3. HSF2 Protein, Human (His)

As a DNA-binding protein, HSF2 protein has specific affinity for the heat shock promoter element (HSE), thereby activating transcription. Notably, in higher eukaryotes, the ability of HSF2 to bind to HSE depends on the exposure of cells to heat shock. HSF2 Protein, Human (His) is the recombinant human-derived HSF2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of HSF2 Protein, Human (His) is 126 a.a., with molecular weight of ~26.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

As a DNA-binding protein, HSF2 protein has specific affinity for the heat shock promoter element (HSE), thereby activating transcription. Notably, in higher eukaryotes, the ability of HSF2 to bind to HSE depends on the exposure of cells to heat shock. HSF2 Protein, Human (His) is the recombinant human-derived HSF2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of HSF2 Protein, Human (His) is 126 a.a., with molecular weight of ~26.0 kDa.

Background

The HSF2 protein serves as a DNA-binding factor with a distinct affinity for heat shock promoter elements (HSE), facilitating the activation of transcription. Notably, in higher eukaryotes, HSF2 demonstrates an intriguing behavior—it remains incapable of binding to HSE unless cells undergo heat shock conditions. Found predominantly as a homodimer in normal cellular states, HSF2 undergoes a transformative shift to a DNA-binding homotrimer configuration in response to cellular stress or heat shock. This trimeric form of HSF2 plays a critical role in initiating transcription, thereby regulating the expression of genes crucial for the cellular response to stress. The dynamic interplay between homodimeric and homotrimeric states underscores the nuanced regulatory function of HSF2 in orchestrating cellular responses to environmental challenges. (

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q03933 (S411-S536)

Gene ID
Molecular Construction
N-term
6*His
HSF2 (S411-S536)
Accession # Q03933
C-term
Synonyms
rHuHeat shock factor protein 2/HSF2, His; Heat Shock Factor Protein 2; HSF 2; Heat Shock Transcription Factor 2; HSTF 2; HSF2; HSTF2
AA Sequence

SENKGLETTKNNVVQPVSEEGRKSKSKPDKQLIQYTAFPLLAFLDGNPASSVEQASTTASSEVLSSVDKPIEVDELLDSSLDPEPTQSKLVRLEPLTEAEASEATLFYLCELAPAPLDSDMPLLDS

Molecular Weight

Approximately 26.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

HSF2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HSF2 Protein, Human (His)
Cat. No.:
HY-P70406
Quantity:
MCE Japan Authorized Agent: