HSPB11 Protein, Human (His)

The HSPB11 protein is an important component of IFT complex B and is indispensable for sonic eager/SHH signaling. It promotes intraflagellar transport in ciliated tissues such as kidney and testis, mediating the transport of SHH components. HSPB11 Protein, Human (His) is the recombinant human-derived HSPB11 protein, expressed by E. coli , with N-6*His labeled tag. The total length of HSPB11 Protein, Human (His) is 144 a.a., with molecular weight of ~21.0 kDa.

HSPB11 protein serves as a crucial component of the IFT complex B, essential for sonic hedgehog/SHH signaling. Its role in intraflagellar transport is particularly prominent in tissues rich in ciliated cells, such as the kidney and testis, where it mediates the transport of SHH components. HSPB11 is indispensable for the export of SMO and PTCH1 receptors out of the cilium and the accumulation of GLI2 at the ciliary tip in response to SHH pathway activation, suggesting its involvement in the dynamic transport of SHH signaling molecules within the cilium. While not required for ciliary assembly, HSPB11 plays a pivotal role in male fertility, spermiogenesis, and sperm flagella formation. Additionally, it contributes to the early development of the kidney and may be involved in the regulation of ureteric bud initiation. As part of the IFT complex B, HSPB11 interacts with other components such as IFT27 and IFT88, highlighting its integral role in the intricate machinery of intraflagellar transport and ciliary function.

Human

E. coli

N-6*His

Q9Y547 (M1-S144)

51668  [NCBI]

MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS

Approximately 21.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.