1. Recombinant Proteins
  2. Others
  3. HSPB11 Protein, Human (His)

The HSPB11 protein is an important component of IFT complex B and is indispensable for sonic eager/SHH signaling. It promotes intraflagellar transport in ciliated tissues such as kidney and testis, mediating the transport of SHH components. HSPB11 Protein, Human (His) is the recombinant human-derived HSPB11 protein, expressed by E. coli , with N-6*His labeled tag. The total length of HSPB11 Protein, Human (His) is 144 a.a., with molecular weight of ~21.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The HSPB11 protein is an important component of IFT complex B and is indispensable for sonic eager/SHH signaling. It promotes intraflagellar transport in ciliated tissues such as kidney and testis, mediating the transport of SHH components. HSPB11 Protein, Human (His) is the recombinant human-derived HSPB11 protein, expressed by E. coli , with N-6*His labeled tag. The total length of HSPB11 Protein, Human (His) is 144 a.a., with molecular weight of ~21.0 kDa.

Background

HSPB11 protein serves as a crucial component of the IFT complex B, essential for sonic hedgehog/SHH signaling. Its role in intraflagellar transport is particularly prominent in tissues rich in ciliated cells, such as the kidney and testis, where it mediates the transport of SHH components. HSPB11 is indispensable for the export of SMO and PTCH1 receptors out of the cilium and the accumulation of GLI2 at the ciliary tip in response to SHH pathway activation, suggesting its involvement in the dynamic transport of SHH signaling molecules within the cilium. While not required for ciliary assembly, HSPB11 plays a pivotal role in male fertility, spermiogenesis, and sperm flagella formation. Additionally, it contributes to the early development of the kidney and may be involved in the regulation of ureteric bud initiation. As part of the IFT complex B, HSPB11 interacts with other components such as IFT27 and IFT88, highlighting its integral role in the intricate machinery of intraflagellar transport and ciliary function.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9Y547 (M1-S144)

Gene ID
Molecular Construction
N-term
6*His
HSPB11 (M1-S144)
Accession # Q9Y547
C-term
Synonyms
Heat Shock Protein Beta-11; Hspb11; Placental Protein 25; PP25; HSPB11; C1orf41
AA Sequence

MRKIDLCLSSEGSEVILATSSDEKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVRIERLVIQSYFVQTLKIEKSTSKEPVDFEQWIEKDLVHTEGQLQNEEIVAHDGSATYLRFIIVSAFDHFASVHSVSAEGTVVSNLSS

Molecular Weight

Approximately 21.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

HSPB11 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HSPB11 Protein, Human (His)
Cat. No.:
HY-P70945
Quantity:
MCE Japan Authorized Agent: