IFN-alpha 2/IFNA2 Protein, Mouse (His)

IFN-alpha 2/IFNA2 Protein, synthesized by macrophages, exhibits potent antiviral activities. Its interaction with IFNAR2 plays a pivotal role in signaling processes, contributing to the intricate network of antiviral defense mechanisms. IFN-alpha 2/IFNA2 Protein, Mouse (His) is the recombinant mouse-derived IFN-alpha 2/IFNA2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of IFN-alpha 2/IFNA2 Protein, Mouse (His) is 167 a.a., with molecular weight of ~20 kDa.

IFN-alpha 2/IFNA2, synthesized primarily by macrophages, possesses potent antiviral activities. Through its interaction with IFNAR2, it engages in crucial signaling processes, contributing to the intricate network of antiviral defense mechanisms.

Measured in a cytotoxicity assay using TF-1 human erythroleukemic cells. The ED₅₀ this effect is 0.7778 ng/mL, corresponding to a specific activity is 1.286 × 10⁶ units/mg.

• 
  Measured in a cytotoxicity assay using TF-1 human erythroleukemic cells. The ED₅₀ for this effect is 1.914 ng/mL, corresponding to a specific activity is 5.225×10⁵ units/mg.

Mouse

E. coli

N-6*His

P01573 (C24-E190)

15965  [NCBI]

CDLPHTYNLRNKRALKVLAQMRRLPFLSCLKDRQDFGFPLEKVDNQQIQKAQAIPVLRDLTQQTLNLFTSKASSAAWNATLLDSFCNDLHQQLNDLQTCLMQQVGVQEPPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLPRLSEEKE

Approximately 20 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.