IFN-alpha 4 Protein, Cynomolgus (HEK293, Fc)

IFN-alpha 4 (IFNA4), belongs to type I interferon family, is produced by macrophages with antiviral activities^[1]. IFN-alpha 4 Protein, Cynomolgus (HEK293, Fc) contains 189 a.a. (M1-N189), produced in HEK293 cells with a C-terminal mFc-tag.

IFN-alpha 4 (IFNA4; IFN-α4), belongs to the alpha/beta interferon (IFN) family, is produced by the macrophages with antiviral activities. Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively^[1].
Interferon alpha (IFNa) shows significant biological activity in various cancers, paticularly haematological malignancies such as hairy cell leukaemia and chronic myelogenous leukaemia^[2].
IFN-alpha 4 is the subtypes dominates in IFN-alpha, whose the response with IFNA5, IFNA7, and IFNA14 accounting for up to 85% of the subtypes expressed by Peripheral blood mononuclear cells (PBMCs)^[3].
IFN-alpha 4 is promoted by interferon (IFN) regulatory factors (IRFs), especially IRF-1 and IRF-7^[5][6]. And it exhibits function by inhibiting virus RNA replication and enhances human natural killer cytotoxicity against virus^[4][7].

Cynomolgus

HEK293

C-mFc

NP_001181313 (C24-N189)

710654  [NCBI]

CDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQTAQAMSVLHEMIQQTFNLFSTKDSSAAWEQNLLEKFSTELYQQLSDLEACVIQEAGVGETPLMNEDSILAVRKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRKKN

Approximately 48 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Zhang SY, et al. Inborn errors of interferon (IFN)-mediated immunity in humans: insights into the respective roles of IFN-alpha/beta, IFN-gamma, and IFN-lambda in host defense. Immunol Rev. 2008 Dec;226:29-40.  [Content Brief]

  [2]. Raj NB, et al. Identification of a novel virus-responsive sequence in the promoter of murine interferon-alpha genes. J Biol Chem. 1991 Jun 15;266(17):11360-5.  [Content Brief]

  [3]. Li Y, et al. Expression Pattern of Individual IFNA Subtypes in Chronic HIV Infection. J Interferon Cytokine Res. 2017 Dec;37(12):541-549.  [Content Brief]

  [4]. Verhagen A, et al. Comparison of augmentation of human natural killer cell cytotoxicity by interferon-alpha subtypes. Nat Immun Cell Growth Regul. 1990;9(5):325-33.  [Content Brief]

  [5]. Au WC, et al. Identification of a member of the interferon regulatory factor family that binds to the interferon-stimulated response element and activates expression of interferon-induced genes. Proc Natl Acad Sci U S A. 1995 Dec 5;92(25):11657-61.  [Content Brief]

  [6]. Lin R, et al. Selective DNA binding and association with the CREB binding protein coactivator contribute to differential activation of alpha/beta interferon genes by interferon regulatory factors 3 and 7. Mol Cell Biol. 2000 Sep;20(17):6342-53.  [Content Brief]