1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-alpha
  5. IFN-alpha 4
  6. IFN-alpha 4/IFNA4 Protein, Mouse (HEK293, His)

IFN-alpha 4/IFNA4 Protein, Mouse (HEK293, His)

Cat. No.: HY-P76403
Handling Instructions Technical Support

IFN-alpha 4 (IFNA4), belongs to type I interferon family, is produced by macrophages with antiviral activities. IFN-alpha 4/IFNA4 Protein, Mouse (HEK293, His) contains 162 a.a. (C25-E186), produced in HEK293 cells with a C-terminal His-tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IFN-alpha 4 (IFNA4), belongs to type I interferon family, is produced by macrophages with antiviral activities[1]. IFN-alpha 4/IFNA4 Protein, Mouse (HEK293, His) contains 162 a.a. (C25-E186), produced in HEK293 cells with a C-terminal His-tag.

Background

IFN-alpha 4 (IFNA4; IFN-α4), belongs to the alpha/beta interferon (IFN) family, is produced by the macrophages with antiviral activities. Interferon (IFN) is originally identified as a substance ‘interfering’ with viral replication in vitro. IFN-α/β and related molecules are classified as type I IFNs, as for the other two types of type II IFN (IFN-γ) and type III IFNs (IFN-λ), respectively[1].
Interferon alpha (IFNa) shows significant biological activity in various cancers, paticularly haematological malignancies such as hairy cell leukaemia and chronic myelogenous leukaemia[2].
IFN-alpha 4 is the subtypes dominates in IFN-alpha, whose the response with IFNA5, IFNA7, and IFNA14 accounting for up to 85% of the subtypes expressed by Peripheral blood mononuclear cells (PBMCs)[3].
IFN-alpha 4 is promoted by interferon (IFN) regulatory factors (IRFs), especially IRF-1 and IRF-7[5][6]. And it exhibits function by inhibiting virus RNA replication and enhances human natural killer cytotoxicity against virus[4][7].
As for a wildly use of IFN in animal model, the sequence of amino acids in IFNA4 protein of mouse shows 80.98% similarity with, but is very different from mouse (59.57%).

In Vitro

The murine IFN-alpha 4 (IFNA4) promoter can be induced by IRF-1 or viral infection, is not induced by IRF-3, which belongs to the family of interferon (IFN) regulatory factors (IRFs)[5].

Biological Activity

Measured in antiviral assays using L929 cells infected with vesicular stomatitisvirus (VSV). The ED50 for this effect is 10-50 pg/mL.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

P07351 (C25-E186)

Gene ID
Molecular Construction
N-term
IFNA4 (C25-E186)
Accession # P07351
His
C-term
Synonyms
Interferon alpha-4; IFN-alpha-4; INFA4
AA Sequence

CDLPHTYNLGNKRALTVLEEMRRLPPLSCLKDRKDFGFPLEKVDNQQIQKAQAILVLRDLTQQILNLFTSKDLSATWNATLLDSFCNDLHQQLNDLKACVMQEPPLTQEDSLLAVRTYFHRITVYLRKKKHSLCAWEVIRAEVWRALSSSTNLLARLSEEKE

Molecular Weight

22-27 kDa.

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

IFN-alpha 4/IFNA4 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-alpha 4/IFNA4 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P76403
Quantity:
MCE Japan Authorized Agent: