1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interferon & Receptors
  4. IFN-α/β Receptor
  5. IFN-alpha/beta R2
  6. IFN-alpha/beta R2 Protein, Mouse (HEK293, His)

IFN-alpha/beta R2 Protein, Mouse (HEK293, His)

Cat. No.: HY-P78772
SDS COA Handling Instructions

IFN-α/β R2 protein and IFNAR1 together constitute the heterodimeric receptor of type I interferon and initiate the JAK-STAT signaling cascade. Upon binding of type I interferons, IFNAR1 and IFNAR2 activate related Janus kinases (TYK2 and JAK1) in proximity, resulting in cross-phosphorylation. IFN-alpha/beta R2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IFN-alpha/beta R2 protein, expressed by HEK293 , with C-His, C-6*His labeled tag. The total length of IFN-alpha/beta R2 Protein, Mouse (HEK293, His) is 221 a.a., with molecular weight of ~37-57 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IFN-α/β R2 protein and IFNAR1 together constitute the heterodimeric receptor of type I interferon and initiate the JAK-STAT signaling cascade. Upon binding of type I interferons, IFNAR1 and IFNAR2 activate related Janus kinases (TYK2 and JAK1) in proximity, resulting in cross-phosphorylation. IFN-alpha/beta R2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IFN-alpha/beta R2 protein, expressed by HEK293 , with C-His, C-6*His labeled tag. The total length of IFN-alpha/beta R2 Protein, Mouse (HEK293, His) is 221 a.a., with molecular weight of ~37-57 kDa.

Background

The IFN-alpha/beta R2 Protein, in conjunction with IFNAR1, constitutes the heterodimeric receptor for type I interferons, encompassing interferons alpha, beta, epsilon, omega, and kappa. Upon type I interferon binding, the receptor activation initiates the JAK-STAT signaling cascade, leading to the transcriptional activation or repression of interferon-regulated genes that mediate the interferon response. Mechanistically, the binding of type I interferon brings IFNAR1 and IFNAR2 into close proximity, facilitating cross-phosphorylation of their associated Janus kinases (JAKs), with TYK2 bound to IFNAR1 and JAK1 bound to IFNAR2. The activated JAKs then phosphorylate specific tyrosine residues on the intracellular domains of IFNAR1 and IFNAR2, creating docking sites for STAT transcription factors (STAT1, STAT2, and STAT). These phosphorylated STAT proteins translocate into the nucleus, regulating the expression of interferon-regulated genes. Additionally, IFN-alpha/beta R2 proteins may function as potent inhibitors of type I interferon receptor activity, showcasing their role in modulating the interferon signaling pathway.

Biological Activity

Immobilized Mouse IFNA2 at 10 μg/mL (100 μL/well) can bind IFNAR2. The ED50 for this effect is 126.3 ng/mL.

  • Immobilized Mouse IFNA2 at 10 μg/mL (100 μL/well) can bind IFNAR2 , The ED50 for this effect is 126.3 ng/mL.
Species

Mouse

Source

HEK293

Tag

C-His;C-6*His

Accession

O35664-1 (S22-A242)

Gene ID
Molecular Construction
N-term
IFNAR2 (S22-A242)
Accession # O35664-1
6*His
C-term
Synonyms
IFNAR2; IFNARB; IFNABR; IFN-R-2; IFN-alpha; beta receptor 2
AA Sequence

SLETITPSAFDGYPDEPCTINITIRNSRLILSWELENKSGPPANYTLWYTVMSKDENLTKVKNCSDTTKSSCDVTDKWLEGMESYVVAIVIVHRGDLTVCRCSDYIVPANAPLEPPEFEIVGFTDHINVTMEFPPVTSKIIQEKMKTTPFVIKEQIGDSVRKKHEPKVNNVTGNFTFVLRDLLPKTNYCVSLYFDDDPAIKSPLKCIVLQPGQESGLSESA

Molecular Weight

Approximately 37-57 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IFN-alpha/beta R2 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IFN-alpha/beta R2 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P78772
Quantity:
MCE Japan Authorized Agent: