IFN-lambda 2/IL-28A Protein, Mouse (HEK293, N-His)

IFN-lambda 2/IL-28A protein is a cytokine with antiviral, antitumor, and immunomodulatory activities. It plays a key role in the antiviral defense of epithelial tissues by binding to IL10RB and IFNLR1 receptor complexes, activating the JAK/STAT signaling pathway. IFN-lambda 2/IL-28A Protein, Mouse (HEK293, N-His) is the recombinant mouse-derived IFN-lambda 2/IL-28A protein, expressed by HEK293 , with N-6*His labeled tag. The total length of IFN-lambda 2/IL-28A Protein, Mouse (HEK293, N-His) is 174 a.a., with molecular weight of ~27 kDa.

IFN-lambda 2/IL-28A Protein, a versatile cytokine, exhibits antiviral, antitumoral, and immunomodulatory activities, playing a crucial role in antiviral host defense, primarily within epithelial tissues. Functioning as a ligand for the heterodimeric class II cytokine receptor, consisting of IL10RB and IFNLR1, its receptor engagement initiates the JAK/STAT signaling pathway, resulting in the expression of IFN-stimulated genes (ISG) that establish an antiviral state. With a confined receptor distribution, it predominantly operates in epithelial cells due to the epithelial cell-specific expression of its receptor IFNLR1. While not deemed essential for early virus-activated host defense in vaginal infection, it assumes a significant role in Toll-like receptor (TLR)-induced antiviral defense and plays a crucial part in the antiviral immune defense in the intestinal epithelium. Additionally, IFN-lambda 2/IL-28A exerts an immunomodulatory effect by up-regulating MHC class I antigen expression, contributing to its impact on immune responses.

Measured in a cell inhibitor assay using A549 cells. The ED₅₀ for this effect is 2.972 ng/mL, corresponding to a specific activity is 3.365×10⁵ units/mg.

• 
  Measured in a cell inhibitor assay using A549 cells. The ED₅₀ for this effect is 2.972 ng/mL , corresponding to a specific activity is 3.365×10⁵ units/mg.

Mouse

HEK293

N-6*His

Q4VK74 (D20-193V)

330496

DPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDLRCSSHLFPRAWDLKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPRSPSRRLSRWLHRLQEAQSKETPGCLEASVTSNLFRLLTRDLKCVANGDQCV

Approximately 27 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS, pH 7.4. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.