IGFBP-7 Protein, Mouse (HEK293, His)

IGFBP-7 Protein, with modest affinity, binds to IGF-I and IGF-II, and notably stimulates prostacyclin (PGI2) production. Beyond its interaction with insulin-like growth factors, IGFBP-7 contributes to cell adhesion, indicating its role in cellular processes associated with adhesion and potential influence on cell-matrix interactions. These functionalities highlight IGFBP-7's diverse roles in modulating growth factor signaling and cellular responses. IGFBP-7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IGFBP-7 protein, expressed by HEK293, with C-His labeled tag. The total length of IGFBP-7 Protein, Mouse (HEK293, His) is 256 a.a., with molecular weight of 32-38 kDa.

The IGFBP-7 Protein exhibits the ability to bind to IGF-I and IGF-II, albeit with relatively low affinity, while also demonstrating the capacity to stimulate prostacyclin (PGI2) production. In addition to its interaction with insulin-like growth factors, IGFBP-7 plays a role in promoting cell adhesion, suggesting its involvement in cellular processes related to adhesion and potentially influencing cell-matrix interactions. These functional characteristics underscore the diverse roles of IGFBP-7 in modulating growth factor signaling and cellular responses.

Mouse

HEK293

C-His

Q61581 (S26-L281)

29817  [NCBI]

SSSDACGPCVPASCPALPRLGCPLGETRDACGCCPVCARGEGEPCGGGAAGRGHCAPGMECVKSRKRRKGKAGAAAGGPATLAVCVCKSRYPVCGSNGITYPSGCQLRAASLRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAKVFLSCEVIGIPTPVLIWNKVKRDHSGVQRTELLPGDRENLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASAAAKITVVDALHEIPLKKGEGAQL

32-38 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.