IL-1 beta Protein, Canine (Tag free)

IL-1 beta Protein, Canine (Tag free) is the recombinant canine-derived IL-1 beta, expressed by E. coli , with tag Free labeled tag. The total length of IL-1 beta Protein, Canine (Tag free) is 152 a.a.,

Measured in a proliferation assay using CTLL-2 Mouse Embryonic Fibroblasts Cells. The ED₅₀ for this effect is 6.864 pg/mL, corresponding to a specific activity is 1.46×10⁸ units/mg.

• 
  Measured in a proliferation assay using CTLL-2 Mouse Embryonic Fibroblasts Cells. The ED₅₀ for this effect is 6.864 pg/mL, corresponding to a specific activity is 1.46×10⁸ units/mg.

Canine

E. coli

Tag Free

Q28292 (A115-S266)

403974

AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS

Approximately 18 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 300 mM NaCl, pH 6.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.