1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-18
  5. IL-18 Protein, Dog (His)

IL-18 protein is a pro-inflammatory cytokine that is critical for epithelial barrier repair and immune regulation, especially in Th1 and NK cell responses. IL18R1 and IL18RAP combine to form a signaling ternary complex that activates NF-kappa-B and induces inflammatory mediators. IL-18 Protein, Dog (His) is the recombinant dog-derived IL-18 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-18 protein is a pro-inflammatory cytokine that is critical for epithelial barrier repair and immune regulation, especially in Th1 and NK cell responses. IL18R1 and IL18RAP combine to form a signaling ternary complex that activates NF-kappa-B and induces inflammatory mediators. IL-18 Protein, Dog (His) is the recombinant dog-derived IL-18 protein, expressed by E. coli , with N-His labeled tag.

Background

IL-18 Protein is a pro-inflammatory cytokine that plays a crucial role in epithelial barrier repair and modulating immune responses, particularly in polarized T-helper 1 (Th1) cell and natural killer (NK) cell immune responses. It forms a signaling ternary complex upon binding to IL18R1 and IL18RAP, activating NF-kappa-B and triggering the synthesis of inflammatory mediators. IL-18 also synergizes with IL-12/interleukin-12 to induce the synthesis of IFNG from Th1 cells and NK cells. In addition, IL-18 is involved in transducing inflammation downstream of pyroptosis, where its mature form is selectively released into the extracellular milieu by passing through the gasdermin-D (GSDMD) pore. It forms a ternary complex with the ligand-binding receptor subunit IL18R1 and the signaling receptor subunit IL18RAP at the plasma membrane, and its interaction with the cargo receptor TMED10 mediates translocation from the cytoplasm into the ERGIC (endoplasmic reticulum-Golgi intermediate compartment) for secretion.

Species

Dog

Source

E. coli

Tag

N-His

Accession

Q9XSR0 (Y37-S193)

Gene ID
Molecular Construction
N-term
His
IL-18 (Y37-S193)
Accession # Q9XSR0
C-term
Synonyms
IL18; IGIF; Interleukin-18; IL-18; Interferon gamma-inducing factor; IFN-gamma-inducing factor; Interleukin-1 gamma; IL-1 gamma
AA Sequence

YFGKLEPKLSIIRNLNDQVLFVNEGNQPVFEDMPDSDCTDNAPHTIFIIYMYKDSLTRGLAVTISVKYKTMSTLSCKNKTISFQKMSPPDSINDEGNDIIFFQRSVPGHDDKIQFESSLYKGHFLACKKENDLFKLILKDKDENGDKSIMFTVQNKS

Molecular Weight

Approximately 22.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

IL-18 Protein, Dog (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-18 Protein, Dog (His)
Cat. No.:
HY-P71657
Quantity:
MCE Japan Authorized Agent: