IL-18 Protein, Dog (His)

IL-18 protein is a pro-inflammatory cytokine that is critical for epithelial barrier repair and immune regulation, especially in Th1 and NK cell responses. IL18R1 and IL18RAP combine to form a signaling ternary complex that activates NF-kappa-B and induces inflammatory mediators. IL-18 Protein, Dog (His) is the recombinant dog-derived IL-18 protein, expressed by E. coli , with N-His labeled tag.

IL-18 Protein is a pro-inflammatory cytokine that plays a crucial role in epithelial barrier repair and modulating immune responses, particularly in polarized T-helper 1 (Th1) cell and natural killer (NK) cell immune responses. It forms a signaling ternary complex upon binding to IL18R1 and IL18RAP, activating NF-kappa-B and triggering the synthesis of inflammatory mediators. IL-18 also synergizes with IL-12/interleukin-12 to induce the synthesis of IFNG from Th1 cells and NK cells. In addition, IL-18 is involved in transducing inflammation downstream of pyroptosis, where its mature form is selectively released into the extracellular milieu by passing through the gasdermin-D (GSDMD) pore. It forms a ternary complex with the ligand-binding receptor subunit IL18R1 and the signaling receptor subunit IL18RAP at the plasma membrane, and its interaction with the cargo receptor TMED10 mediates translocation from the cytoplasm into the ERGIC (endoplasmic reticulum-Golgi intermediate compartment) for secretion.

Dog

E. coli

N-His

Q9XSR0 (Y37-S193)

403796  [NCBI]

YFGKLEPKLSIIRNLNDQVLFVNEGNQPVFEDMPDSDCTDNAPHTIFIIYMYKDSLTRGLAVTISVKYKTMSTLSCKNKTISFQKMSPPDSINDEGNDIIFFQRSVPGHDDKIQFESSLYKGHFLACKKENDLFKLILKDKDENGDKSIMFTVQNKS

Approximately 22.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.