IL-1RA/IL-1RN Protein, Human (HEK293)

IL-1RA/IL-1RN Protein, Human (HEK293) is a member of the IL-1 family that binds to IL-1 receptors.

The production of Human Interleukin-1 Receptor Antagonist Protein (IL-1ra) is stimulated by many substances including adherent IgG, other cytokines, and bacterial or viral components. Endogenous IL-1Ra is produced in numerous experimental animal models of disease as well as in human autoimmune and chronic inflammatory diseases. Treatment of human diseases with recombinant human IL-1Ra shows an absence of benefit in sepsis syndrome^[1]. IL-1 receptor antagonist (IL-1ra) has provided a tool for blocking IL-1 activity in vivo, leading to a detailed understanding of the role of this cytokine in the inflammatory response^[2].

1.The ED₅₀ is <0.1 μg /mL as measured by D10S cells in the presence of 50.0 pg/mL Human IL-1a.
2.Measured by its ability to inhibit IL-1 alpha -dependent proliferation in CTLL-2 mouse cytotoxic T cells.The ED₅₀ for this effect is 70.48 ng/mL in the presence of 50 pg/mL of rhIL-1 alpha, corresponding to a specific activity is 1.419×10⁴ units/mg.

• 
  Measured by its ability to inhibit IL-1 alpha -dependent proliferation in CTLL-2 mouse cytotoxic T cells.The ED₅₀ for this effect is 70.48 ng/mL in the presence of 50 pg/mL of rhIL-1 alpha, corresponding to a specific activity is 1.419×10⁴ units/mg.

Human

HEK293

Tag Free

P18510-1 (R26-E177)

3557  [NCBI]

RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE

Approximately 21.15 & 23.35kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Arend WP, et al. Interleukin-1 receptor antagonist: role in biology. Annu Rev Immunol. 1998;16:27-55.  [Content Brief]

  [2]. Nikolic-Paterson DJ, et al. Interleukin-1 receptor antagonism. Semin Nephrol. 1996 Nov;16(6):583-90.  [Content Brief]

  [3]. Arend WP, et al. Interleukin 1 receptor antagonist. A new member of the interleukin 1 family. J Clin Invest. 1991 Nov;88(5):1445-51.  [Content Brief]