CD47 Protein, Cynomolgus/Rhesus Macaque (HEK293, Fc)

CD47 is a leukocyte surface antigen, and high expression of CD47 helps tumors escape. CD47 inhibition leads to the activation of CD103+ dendritic cells, which leads to the recruitment and activation of natural killer cells and inhibits cancer development. CD47 Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived CD47 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD47 Protein, Rhesus Macaque (HEK293, Fc) is 121 a.a., with molecular weight of 60-90 kDa.

CD47 is a receptor for the C-terminal cell-binding domain of leukocyte surface antigen and thrombospondin. CD47 controls the increase in intracellular calcium concentration when cells adhere to the extracellular matrix and may play a role in membrane trafficking and signal transduction. The CD47 gene has broad tissue distribution and low expression on Rh erythrocytes. High expression levels of CD47 help cancer cells evade the immune system. For example, studies have found that high expression of CD47 is associated with poor prognosis in HCC patients. CD47 inhibition can enhance the ability of CD103+ DCs to take up tumor DNA, thereby stimulating the cGAS-STING pathway and promoting the infiltration and activation of liver natural killer cells in cancer cells. CD47 also binds to proteins including thrombospondin-1 (TSP-1), signal regulatory protein alpha (SIRPα), integrins, and protein tyrosine phosphatase substrate with SH2 domain-1 (SHPS-1). Ligand. and regulates phagocytosis of macrophages, migration of neutrophils, and activation of dendritic cells, T cells, and B cells. Some CD47 antibodies may inhibit the CD47-SIRPα axis to enhance phagocytosis of cancer cells.

1.10 μg/mL (100 μL/well) of immobilized recombinant Rhesus Macaque Integrin-associated protein/CD47-Fc can bind Anti-Human CD47 mAb-IgG4Fc with an ED₅₀ value of 76.1 ng/mL.
2.Measured by its binding ability in a functional ELISA. Immobilized Human SIRP alpha at 2μg/mL (100 μL/well) can bind Cynomolgus CD47. The ED₅₀ for this effect is 0.19 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Human SIRP alpha at 2μg/mL (100 μL/well) can bind Cynomolgus CD47. The ED₅₀ for this effect is 0.19 μg/mL.

Rhesus Macaque; Cynomolgus

HEK293

C-hFc

F7A802/NP_001253446 (Q19-S139)

704980  [NCBI]/102139846

QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTAPANFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFS

Approximately 60-90 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris, 100 mM Glycine, pH 7.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.