ITGBL1 Protein, Human (Myc, His)

Integrin beta-like protein 1 (ITGBL1) is a beta integrin-related protein that is a member of the EGF-like protein family, containing integrin-like cysteine-rich repeats and may has integrin binding activity. ITGBL1 might be involved in cell adhesion mediated by integrin; cell-matrix adhesion; and integrin-mediated signaling pathway. ITGBL1 Protein, Human (Myc, His) is the recombinant human-derived ITGBL1 protein, expressed by E. coli , with C-Myc, N-10*His labeled tag. The total length of ITGBL1 Protein, Human (Myc, His) is 471 a.a., with molecular weight of ~67 kDa.

Integrin beta-like protein 1 (ITGBL1) is a beta integrin-related protein that is a member of the EGF-like protein family. ITGBL1 contains integrin-like cysteine-rich repeats and may has integrin binding activity. ITGBL1 might be involved in cell adhesion mediated by integrin; cell-matrix adhesion; and integrin-mediated signaling pathway. ITGBL1 is predicted to be located in extracellular region; part of integrin complex; and active in cell surface and focal adhesion. Alternative splicing of ITGBL1 gene results in multiple transcript variants^[1][2].

Human

E. coli

C-Myc;N-10*His

O95965 (V24-P494)

9358  [NCBI]

VPQSFSPSLRSWPGAACRLSRAESERRCRAPGQPPGAALCHGRGRCDCGVCICHVTEPGMFFGPLCECHEWVCETYDGSTCAGHGKCDCGKCKCDQGWYGDACQYPTNCDLTKKKSNQMCKNSQDIICSNAGTCHCGRCKCDNSDGSGLVYGKFCECDDRECIDDETEEICGGHGKCYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGVVCGGHGTCSCGRCVCERGWFGKLCQHPRKCNMTEEQSKNLCESADGILCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGWNGNACEIWLGSEYP

Approximately 67 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.