1. Recombinant Proteins
  2. Others
  3. ITGBL1 Protein, Human (Myc, His)

Integrin beta-like protein 1 (ITGBL1) is a beta integrin-related protein that is a member of the EGF-like protein family, containing integrin-like cysteine-rich repeats and may has integrin binding activity. ITGBL1 might be involved in cell adhesion mediated by integrin; cell-matrix adhesion; and integrin-mediated signaling pathway. ITGBL1 Protein, Human (Myc, His) is the recombinant human-derived ITGBL1 protein, expressed by E. coli , with C-Myc, N-10*His labeled tag. The total length of ITGBL1 Protein, Human (Myc, His) is 471 a.a., with molecular weight of ~67 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Integrin beta-like protein 1 (ITGBL1) is a beta integrin-related protein that is a member of the EGF-like protein family, containing integrin-like cysteine-rich repeats and may has integrin binding activity. ITGBL1 might be involved in cell adhesion mediated by integrin; cell-matrix adhesion; and integrin-mediated signaling pathway. ITGBL1 Protein, Human (Myc, His) is the recombinant human-derived ITGBL1 protein, expressed by E. coli , with C-Myc, N-10*His labeled tag. The total length of ITGBL1 Protein, Human (Myc, His) is 471 a.a., with molecular weight of ~67 kDa.

Background

Integrin beta-like protein 1 (ITGBL1) is a beta integrin-related protein that is a member of the EGF-like protein family. ITGBL1 contains integrin-like cysteine-rich repeats and may has integrin binding activity. ITGBL1 might be involved in cell adhesion mediated by integrin; cell-matrix adhesion; and integrin-mediated signaling pathway. ITGBL1 is predicted to be located in extracellular region; part of integrin complex; and active in cell surface and focal adhesion. Alternative splicing of ITGBL1 gene results in multiple transcript variants[1][2].

Species

Human

Source

E. coli

Tag

C-Myc;N-10*His

Accession

O95965 (V24-P494)

Gene ID
Molecular Construction
N-term
10*His
ITGBL1 (V24-P494)
Accession # O95965
Myc
C-term
Synonyms
ITGBL1; OSCP; TIED; Integrin beta-like protein 1; Osteoblast-specific cysteine-rich protein; Ten integrin EGF-like repeat domain-containing protein
AA Sequence

VPQSFSPSLRSWPGAACRLSRAESERRCRAPGQPPGAALCHGRGRCDCGVCICHVTEPGMFFGPLCECHEWVCETYDGSTCAGHGKCDCGKCKCDQGWYGDACQYPTNCDLTKKKSNQMCKNSQDIICSNAGTCHCGRCKCDNSDGSGLVYGKFCECDDRECIDDETEEICGGHGKCYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGVVCGGHGTCSCGRCVCERGWFGKLCQHPRKCNMTEEQSKNLCESADGILCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGWNGNACEIWLGSEYP

Molecular Weight

Approximately 67 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ITGBL1 Protein, Human (Myc, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ITGBL1 Protein, Human (Myc, His)
Cat. No.:
HY-P71448
Quantity:
MCE Japan Authorized Agent: