JAML/AMICA Protein, Mouse (HEK293, Fc)

JAML/AMICA proteins are predicted to have integrin-binding and homodimerization activities, regulate gamma-delta T cell activation and promote epithelial cell proliferation in wound healing. It mainly exists in the plasma membrane, is an ortholog of human JAML, and is involved in cell adhesion. JAML/AMICA Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived JAML/AMICA protein, expressed by HEK293 , with C-hFc labeled tag.

JAML/AMICA Protein is predicted to possess integrin binding activity and protein homodimerization activity. It plays a role in gamma-delta T cell activation and positively regulates epithelial cell proliferation, particularly in processes related to wound healing. The protein is primarily located in the plasma membrane. As an ortholog to human JAML (junction adhesion molecule like), JAML/AMICA is implicated in cellular adhesion processes. Despite its functional significance, low expression levels have been observed in the reference dataset, suggesting that its regulatory functions may be tightly controlled or context-dependent. The gene's association with cell adhesion processes and its low expression levels highlight its potential involvement in specific physiological contexts, particularly those related to immune response and tissue repair.

Measured by the ability of the immobilized protein to support the adhesion of the A549 Human non-small cell lung cancer cells. The adhesion rate for this effect is 55.10 % in the presence of 10 μg/mL JAML.

Mouse

HEK293

C-hFc

Q80UL9/NP_001005421.3 (Q21-L281)

270152  [NCBI]

QGLPGLTVSSPQLRVHVGESVLMGCVVQRTEEKHVDRVDWLFSKDKDDASEYVLFYYSNLSVPTGRFQNRSHLVGDTFHNDGSLLLQDVQKADEGIYTCEIRLKNESMVMKKPVELWVLPEEPKDLRVRVGDTTQMRCSIQSTEEKRVTKVNWMFSSGSHTEEETVLSYDSNMRSGKFQSLGRFRNRVDLTGDISRNDGSIKLQTVKESDQGIYTCSIYVGKLESRKTIVLHVVQDEFQRTISPTPPTDKGQQGILNGNQL

Approximately 56.5 kDa.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.