Kallikrein-1 Protein, Mouse (HEK293, His)

Kallikrein-1 protein is a member of the glandular kallikrein family and plays a vital role in enzyme activity by cleaving the Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin..This proteolysis is critical for the production of bradykinin, a bioactive peptide involved in multiple physiological processes, including blood pressure regulation, inflammation, and vascular permeability.Kallikrein-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Kallikrein-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Kallikrein-1 is a protein belonging to the glandular kallikrein family, and it exhibits proteolytic activity by cleaving Met-Lys and Arg-Ser bonds in kininogen, leading to the release of Lys-bradykinin. This enzymatic activity positions Kallikrein-1 as a key player in the kinin-kallikrein system, a complex pathway involved in the regulation of blood pressure, inflammation, and vascular permeability. By generating Lys-bradykinin, Kallikrein-1 contributes to the production of bradykinin, a potent vasoactive peptide with various physiological effects.

Mouse

HEK293

C-6*His

P15947 (P19-D261)

16612  [NCBI]

PPVQSRIVGGFNCEKNSQPWQVAVYRFTKYQCGGILLNANWVLTAAHCHNDKYQVWLGKNNFLEDEPSAQHRLVSKAIPHPDFNMSLLNEHTPQPEDDYSNDLMLLRLKKPADITDVVKPIDLPTEEPKLGSTCLASGWGSITPVKYEYPDELQCVNLKLLPNEDCAKAHIEKVTDDMLCAGDMDGGKDTCAGDSGGPLICDGVLQGITSWGPSPCGKPNVPGIYTRVLNFNTWIRETMAEND

34-38 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.