KDELR2 Protein, Mouse (Cell-Free, His)

KDELR2 Protein, a membrane receptor, crucially maintains endoplasmic reticulum (ER) resident proteins' localization. It binds the K-D-E-L sequence motif, retaining these proteins within the ER. This interaction facilitates vesicle-mediated recycling, ensuring proper subcellular localization through Golgi-to-ER protein return. KDELR2's pH-dependent binding, optimal at pH 5-5.4, underscores the regulatory role of pH in this vital cellular process. KDELR2 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived KDELR2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of KDELR2 Protein, Mouse (Cell-Free, His) is 212 a.a., with molecular weight of 26.0 kDa.

KDELR2 Protein, a membrane receptor, functions as a crucial participant in the maintenance of endoplasmic reticulum (ER) resident proteins' localization. The receptor binds to the K-D-E-L sequence motif located in the C-terminal region of these proteins, facilitating their retention within the ER. This interaction is pivotal for the vesicle-mediated recycling process that ensures the return of ER-resident proteins from the Golgi apparatus to the ER, contributing to their proper subcellular localization. Notably, the binding affinity of KDELR2 is pH-dependent, with optimal binding occurring at a slightly acidic pH range of 5-5.4, underscoring the regulatory role of pH in this vital cellular process.

Mouse

E. coli Cell-free

N-10*His

Q9CQM2 (M1-A212)

66913

MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYNTSMKLIYIACSYATVYLIYMKFKATYDGNHDTFRVEFLVVPVGGLSFLVNHDFSPLEILWTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLVNWIWRFYFEGFFDLIAVVAGVVQTILYCDFFYLYITKVLKGKKLSLPA

Approximately 24 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, 0.05% Brij-78, 6%Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.