1. Recombinant Proteins
  2. Receptor Proteins
  3. KDELR2 Protein, Mouse (Cell-Free, His)

KDELR2 Protein, a membrane receptor, crucially maintains endoplasmic reticulum (ER) resident proteins' localization. It binds the K-D-E-L sequence motif, retaining these proteins within the ER. This interaction facilitates vesicle-mediated recycling, ensuring proper subcellular localization through Golgi-to-ER protein return. KDELR2's pH-dependent binding, optimal at pH 5-5.4, underscores the regulatory role of pH in this vital cellular process. KDELR2 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived KDELR2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of KDELR2 Protein, Mouse (Cell-Free, His) is 212 a.a., with molecular weight of 26.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

KDELR2 Protein, a membrane receptor, crucially maintains endoplasmic reticulum (ER) resident proteins' localization. It binds the K-D-E-L sequence motif, retaining these proteins within the ER. This interaction facilitates vesicle-mediated recycling, ensuring proper subcellular localization through Golgi-to-ER protein return. KDELR2's pH-dependent binding, optimal at pH 5-5.4, underscores the regulatory role of pH in this vital cellular process. KDELR2 Protein, Mouse (Cell-Free, His) is the recombinant mouse-derived KDELR2 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of KDELR2 Protein, Mouse (Cell-Free, His) is 212 a.a., with molecular weight of 26.0 kDa.

Background

KDELR2 Protein, a membrane receptor, functions as a crucial participant in the maintenance of endoplasmic reticulum (ER) resident proteins' localization. The receptor binds to the K-D-E-L sequence motif located in the C-terminal region of these proteins, facilitating their retention within the ER. This interaction is pivotal for the vesicle-mediated recycling process that ensures the return of ER-resident proteins from the Golgi apparatus to the ER, contributing to their proper subcellular localization. Notably, the binding affinity of KDELR2 is pH-dependent, with optimal binding occurring at a slightly acidic pH range of 5-5.4, underscoring the regulatory role of pH in this vital cellular process.

Species

Mouse

Source

E. coli Cell-free

Tag

N-10*His

Accession

Q9CQM2 (M1-A212)

Gene ID

66913

Molecular Construction
N-term
10*His
KDELR2 (M1-A212)
Accession # Q9CQM2
C-term
Synonyms
ER lumen protein-retaining receptor 2; KDEL endoplasmic reticulum protein retention receptor 2; KDEL receptor 2
AA Sequence

MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYNTSMKLIYIACSYATVYLIYMKFKATYDGNHDTFRVEFLVVPVGGLSFLVNHDFSPLEILWTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLVNWIWRFYFEGFFDLIAVVAGVVQTILYCDFFYLYITKVLKGKKLSLPA

Molecular Weight

Approximately 24 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 0.05% Brij-78, 6%Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

KDELR2 Protein, Mouse (Cell-Free, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KDELR2 Protein, Mouse (Cell-Free, His)
Cat. No.:
HY-P702352
Quantity:
MCE Japan Authorized Agent: