KGF-2/FGF-10 Protein, Human (N-His)

KGF-2/FGF-10 Protein orchestrates embryonic development, regulating cell proliferation and differentiation, with indispensable significance in branching morphogenesis. This versatile protein potentially contributes to wound healing. Engaging with FGFR1 and FGFR2, it forms molecular complexes, highlighting its multifaceted functions. Interactions with FGFBP1 emphasize its intricate network in orchestrating cellular responses and developmental events during embryogenesis. KGF-2/FGF-10 Protein, Human (N-His) is the recombinant human-derived KGF-2/FGF-10 protein, expressed by E. coli, with N-His labeled tag. The total length of KGF-2/FGF-10 Protein, Human (N-His) is 169 a.a., with molecular weight of 21-23 kDa.

KGF-2/FGF-10 Protein assumes a crucial role in orchestrating embryonic development, exerting regulatory control over essential processes such as cell proliferation and differentiation. Its significance extends to the intricate domain of normal branching morphogenesis, where KGF-2/FGF-10 is indispensable. This versatile protein may also contribute to wound healing processes. Through crucial interactions, it engages with FGFR1 and FGFR2, forming molecular complexes that underlie its multifaceted functions. Furthermore, KGF-2/FGF-10 interacts with FGFBP1, emphasizing its intricate network of associations in orchestrating cellular responses and developmental events.

Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED₅₀ for this effect is 9.599-57.42 ng/mL.

• 
  Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED₅₀ for this effect is 9.599 ng/mL, corresponding to a specific activity is 1.042×10⁵ units/mg.

Human

E. coli

N-His

O15520 (L40-S208)

2255  [NCBI]

LGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS

21-23 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.