KGF/FGF-7 Protein, Human (N-His)

KGF/FGF-7 Protein, Human (His) is a polypeptide mitogen that belongs to the family of fibroblast growth factors, binds only to a splice variant of FGFR2 (FGFR2 IIIb) and is a highly specific paracrine growth factor for epithelial cells. KGF/FGF-7 Protein, Human (His) and its receptor are important for normal wound healing.

Keratinocyte growth factor 1 or FGF-7 is a polypeptide mitogen that belongs to the family of fibroblast growth factors, binds only to a splice variant of FGFR2 (FGFR2 IIIb) and is a highly specific paracrine growth factor for epithelial cells. FGF-7 and its receptor are believed to be important for normal wound healing^[1].

Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED₅₀ for this effect is 20.85 ng/mL, corresponding to a specific activity is 4.796×10⁴ units/mg.

Human

E. coli

N-6*His

P21781-1 (C32-T194)

2252  [NCBI]

CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

Approximately 23 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Trowbridge JM, et al. Dermatan sulfate binds and potentiates activity of keratinocyte growth factor (FGF-7). J Biol Chem. 2002 Nov 8;277(45):42815-20.  [Content Brief]