1. Recombinant Proteins
  2. Receptor Proteins
  3. Killer-Cell Immunoglobulin-like Receptors
  4. CD158b2/KIR2DL3
  5. KIR2DL3 Protein, Human (HEK293, His)

KIR2DL3, found on NK cells, selectively recognizes HLA-C alleles like HLA-Cw1, HLA-Cw3, and HLA-Cw7. Its interaction leads to inhibitory effects, preventing NK cell activity and cell lysis. KIR2DL3's association with ARRB2 underscores its role in cellular signaling pathways, intricately modulating NK cell functions. KIR2DL3 Protein, Human (HEK293, His) is the recombinant human-derived KIR2DL3 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

KIR2DL3, found on NK cells, selectively recognizes HLA-C alleles like HLA-Cw1, HLA-Cw3, and HLA-Cw7. Its interaction leads to inhibitory effects, preventing NK cell activity and cell lysis. KIR2DL3's association with ARRB2 underscores its role in cellular signaling pathways, intricately modulating NK cell functions. KIR2DL3 Protein, Human (HEK293, His) is the recombinant human-derived KIR2DL3 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

KIR2DL3, expressed on natural killer (NK) cells, functions as a receptor specifically recognizing HLA-C alleles, such as HLA-Cw1, HLA-Cw3, and HLA-Cw7. Through this interaction, KIR2DL3 exerts inhibitory effects on NK cell activity, playing a crucial role in preventing cell lysis. The receptor further engages with ARRB2, highlighting its involvement in intricate cellular signaling pathways that modulate NK cell functions.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P43628-1 (H22-H245)

Gene ID
Molecular Construction
N-term
KIR2DL3 (H22-H245)
Accession # P43628-1
6*His
C-term
Synonyms
rHuKiller cell immunoglobulin-like receptor 2DL3/KIR2DL3, His; Killer Cell Immunoglobulin-Like Receptor 2DL3; CD158 Antigen-Like Family Member B2; KIR-023GB; Killer Inhibitory Receptor cl 2-3; MHC Class I NK Cell Receptor; NKAT2a; NKAT2b; Natural Killer-Associated Transcript 2; NKAT-2; p58 Natural Killer Cell Receptor Clone C
AA Sequence

HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH

Molecular Weight

35-50 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

KIR2DL3 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KIR2DL3 Protein, Human (HEK293, His)
Cat. No.:
HY-P70354
Quantity:
MCE Japan Authorized Agent: