KIR3DS1/CD158e2 Protein, Human (CHO)

KIR3DS1/CD158e2, located on NK cells, serves as a receptor for MHC class I molecules. Its crucial role includes triggering NK cell degranulation and inducing the production of anti-viral cytokines upon interaction with the peptide-free HLA-F open conformer. This direct engagement highlights KIR3DS1/CD158e2 as a key modulator of NK cell responses, particularly in anti-viral immune reactions. KIR3DS1/CD158e2 Protein, Human (CHO) is the recombinant human-derived KIR3DS1/CD158e2 protein, expressed by CHO , with tag free. The total length of KIR3DS1/CD158e2 Protein, Human (CHO) is 319 a.a., with molecular weight of 75-90 kDa.

KIR3DS1/CD158e2, situated on natural killer (NK) cells, functions as a receptor for MHC class I molecules. Its pivotal role involves triggering NK cell degranulation and promoting the production of anti-viral cytokines upon interaction with the peptide-free HLA-F open conformer. The direct interaction with HLA-F open conformer underscores the specificity of this receptor-ligand engagement, highlighting KIR3DS1/CD158e2 as a key player in modulating NK cell responses, particularly in the context of anti-viral immune reactions.

Immobilized Human KIR3DS1, at 2 μg/mL (100μL/well) can bind Anti-KIR3DS1 antibody. The ED₅₀ for this effect is 0.9047 μg/mL.

Human

CHO

C-6*His

Q14943-1 (H22-H340)

3813  [NCBI]

HMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLH

Approximately 40-57 kDa due to the glycosylation.

Greater than 90% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.