Klrb1a Protein, Mouse (HEK293, His)

The Klrb1a protein is critical for stimulating NK cell cytotoxicity and contributes to immune defense mechanisms.Klrb1a exists as a homodimer with disulfide bonds and complexly regulates NK cell activity.Klrb1a Protein, Mouse (HEK293, His) is the recombinant mouse-derived Klrb1a protein, expressed by HEK293 , with N-His labeled tag.

The Klrb1a protein plays a pivotal role in stimulating natural killer (NK) cell cytotoxicity, contributing to the immune system's defense mechanisms. Existing as a homodimer with disulfide linkages, Klrb1a is intricately involved in modulating the activity of NK cells. Its interaction with the tyrosine kinase LCK suggests a potential mechanism for signal transduction or regulatory processes that enhance NK cell cytotoxicity. Through these molecular interactions, Klrb1a plays a key role in the orchestration of immune responses, particularly in the activation and regulation of NK cells, thereby contributing to the body's defense against various threats.

Mouse

HEK293

N-His

P27811 (Q67-H227)

17057  [NCBI]

QKPSIEKCYVLIQENLNKTTDCSAKLECPQDWLSHRDKCFHVSHVSNTWEEGLVDCDGKGATLMLIQDQEELRFLLDSIKEKYNSFWIGLRYTLPDMNWKWINGSTLNSDVLKITDDTENDSCAAISGDKVTFESCNSDNRWICQKELYHETLSNYVGYGH

Approximately 24-33 kDa due to the glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.