LAMP3/CD208 Protein, Rhesus Macaque (HEK293, His)

The LAMP3/CD208 protein is a lysosomal membrane glycoprotein that actively participates in the unfolded protein response (UPR), aiding protein degradation and cell survival during proteasome dysfunction. It is essential for lysosome-autophagosome fusion, where it regulates the autophagy process. LAMP3/CD208 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived LAMP3/CD208 protein, expressed by HEK293 , with C-His labeled tag. The total length of LAMP3/CD208 Protein, Rhesus Macaque (HEK293, His) is 354 a.a., with molecular weight of ~60-95 KDa.

LAMP3/CD208 protein, a lysosomal membrane glycoprotein, actively participates in the unfolded protein response (UPR), contributing to protein degradation and cell survival under conditions of proteasomal dysfunction. Additionally, it plays a crucial role in facilitating the fusion of lysosomes with autophagosomes, thereby modulating the autophagic process. Beyond its role in cellular homeostasis, LAMP3/CD208 functions in promoting hepatocellular lipogenesis by activating the PI3K/Akt pathway. Moreover, there is evidence suggesting its involvement in dendritic cell function and adaptive immunity. Structurally, LAMP3/CD208 acts as a monomer and interacts with FURIN to carry out its diverse cellular functions.

Measured by its ability to enhance MDA-MB-231 cells migration. The ED₅₀ for this effect is 0.397 μg/mL, corresponding to a specific activity is 2.516×10³ U/mg.

• 
  Measured by its ability to enhance MDA-MB-231 cells migration. The ED₅₀ for this effect is 0.397 μg/mL, corresponding to a specific activity is 2.516×10³ U/mg.

Rhesus Macaque

HEK293

C-6*His

Q8MJJ2 (K28-T381)

574213  [NCBI]

KAFPKTRDYSQPTAAATGQDIAKPVQQPANQAPHQTLAARLMDGHITFQTAATIKTPTTTPVTTKNTPTTSPIIYTLVTTQATSNNSHTAPPLTKVTVGPSLAPYSLPPTITPPAHTTGTSSSTVNHTTGNATQPSNQTTLPATLSIAPHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGSTLAPQPSSIKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNLDPNATQASGNCGTRNSNLLLNFQGGFVNLTFTKDEGSYYISEVGACLTVSDPETIYQGMKHAVVMFQTVVGHSFKCVSEQSLQLSAHLQLKTTNVQLQAFDFEDDHFGNVDECSSDYT

Approximately 60-95 kDa due to the glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, PH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.