1. Recombinant Proteins
  2. CD Antigens
  3. LAMP3/CD208 Protein, Rhesus Macaque (HEK293, His)

LAMP3/CD208 Protein, Rhesus Macaque (HEK293, His)

Cat. No.: HY-P77436
Handling Instructions Technical Support

The LAMP3/CD208 protein is a lysosomal membrane glycoprotein that actively participates in the unfolded protein response (UPR), aiding protein degradation and cell survival during proteasome dysfunction. It is essential for lysosome-autophagosome fusion, where it regulates the autophagy process. LAMP3/CD208 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived LAMP3/CD208 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The LAMP3/CD208 protein is a lysosomal membrane glycoprotein that actively participates in the unfolded protein response (UPR), aiding protein degradation and cell survival during proteasome dysfunction. It is essential for lysosome-autophagosome fusion, where it regulates the autophagy process. LAMP3/CD208 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived LAMP3/CD208 protein, expressed by HEK293 , with C-His labeled tag.

Background

LAMP3/CD208 protein, a lysosomal membrane glycoprotein, actively participates in the unfolded protein response (UPR), contributing to protein degradation and cell survival under conditions of proteasomal dysfunction. Additionally, it plays a crucial role in facilitating the fusion of lysosomes with autophagosomes, thereby modulating the autophagic process. Beyond its role in cellular homeostasis, LAMP3/CD208 functions in promoting hepatocellular lipogenesis by activating the PI3K/Akt pathway. Moreover, there is evidence suggesting its involvement in dendritic cell function and adaptive immunity. Structurally, LAMP3/CD208 acts as a monomer and interacts with FURIN to carry out its diverse cellular functions.

Biological Activity

Measured by its ability to enhance MDA-MB-231 cells migration. The ED50 for this effect is 0.397 μg/mL, corresponding to a specific activity is 2.516×103 U/mg.

  • Measured by its ability to enhance MDA-MB-231 cells migration. The ED50 for this effect is 0.397 μg/mL, corresponding to a specific activity is 2.516×103 U/mg.
Species

Rhesus Macaque

Source

HEK293

Tag

C-6*His

Accession

Q8MJJ2 (K28-T381)

Gene ID
Molecular Construction
N-term
LAMP3 (K28-T381)
Accession # Q8MJJ2
His
C-term
Synonyms
Lysosome-associated membrane glycoprotein 3; LAMP-3; DCLAMP; TSC403
AA Sequence

KAFPKTRDYSQPTAAATGQDIAKPVQQPANQAPHQTLAARLMDGHITFQTAATIKTPTTTPVTTKNTPTTSPIIYTLVTTQATSNNSHTAPPLTKVTVGPSLAPYSLPPTITPPAHTTGTSSSTVNHTTGNATQPSNQTTLPATLSIAPHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGSTLAPQPSSIKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNLDPNATQASGNCGTRNSNLLLNFQGGFVNLTFTKDEGSYYISEVGACLTVSDPETIYQGMKHAVVMFQTVVGHSFKCVSEQSLQLSAHLQLKTTNVQLQAFDFEDDHFGNVDECSSDYT

Molecular Weight

Approximately 60-95 kDa due to the glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, PH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LAMP3/CD208 Protein, Rhesus Macaque (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LAMP3/CD208 Protein, Rhesus Macaque (HEK293, His)
Cat. No.:
HY-P77436
Quantity:
MCE Japan Authorized Agent: