LDHA Protein, Human (His)

LDHA protein catalyzes the stereospecific interconversion of pyruvate and lactate, concomitantly exchanging NADH and NAD(+). LDHA Protein, Human (His) is the recombinant human-derived LDHA protein, expressed by E. coli , with N-6*His labeled tag.

LDHA protein catalyzes the simultaneous and stereospecific interconversion of pyruvate and lactate, accompanied by the reciprocal interconversion of NADH and NAD(+).

Measured by its ability to reduce pyruvate to lactate. The specific activity is > 70000 pmol/min/μg, as measured under the described conditions.

Human

E. coli

N-6*His

P00338-1 (M1-F332)

3939  [NCBI]

MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF

Approximately 34.0-38.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 500 mM NaCl, 5% Trehalose, 5% Mannitol, 0.01% Tween80, 1 mM EDTA, 50% Glycerol, pH 8.0 or 20 mM Tris-HCL, 100 mM NaCl, pH 8.0, 20% Glycerol.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.