1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily
  4. TGF-beta Receptor
  5. Lefty-A/TGF-beta 4 Protein, Human (HEK293, His)

Lefty-A/TGF-beta 4 Protein, Human (HEK293, His)

Cat. No.: HY-P70191
Handling Instructions Technical Support

Lefty-A, or TGF-beta 4, plays a crucial role in determining left-right (L-R) asymmetry in mammalian organ systems. Its implication in endometrial bleeding suggests a potential role in reproductive processes, highlighting its significance beyond embryonic development. Lefty-A/TGF-beta 4 Protein, Human (HEK293, His) is the recombinant human-derived Lefty-A/TGF-beta 4 protein, expressed by HEK293 , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Lefty-A, or TGF-beta 4, plays a crucial role in determining left-right (L-R) asymmetry in mammalian organ systems. Its implication in endometrial bleeding suggests a potential role in reproductive processes, highlighting its significance beyond embryonic development. Lefty-A/TGF-beta 4 Protein, Human (HEK293, His) is the recombinant human-derived Lefty-A/TGF-beta 4 protein, expressed by HEK293 , with N-6*His labeled tag.

Background

Lefty-A, also known as TGF-beta 4, is crucial for the determination of left-right (L-R) asymmetry in organ systems within mammals. Its involvement in endometrial bleeding suggests a potential role in reproductive processes, emphasizing its significance beyond embryonic development.

Biological Activity

1.Measured by its ability to induce cell death using Mv1Lu mink lung epithelial cells. The ED50 for this effect is 0.9733-2.015 μg/mL. 2.Measured by its ability to induce cell death using Mv1Lu mink lung epithelial cells. The ED50 for this effect is 1.805 μg/mL, corresponding to a specific activity is 554.017 units/mg.

  • Measured by its ability to induce cell death using Mv1Lu mink lung epithelial cells. The ED50 for this effect is 0.9733 μg/mL, corresponding to a specific activity is 1.027×103 units/mg.
Species

Human

Source

HEK293

Tag

N-6*His

Accession

O00292 (L22-K76) & O00292 (F78-P366)

Gene ID
Molecular Construction
N-term
Propeptide (L22-K76)-6*His
Lefty-A (F78-P366)
Accession # O00292
C-term
Synonyms
rHuLeft-right determination factor 2, His; Left-right determination factor 2; Endometrial bleeding-associated factor; Left-right determination factor A; Protein lefty-2; Protein lefty-A; Transforming growth factor beta-4; TGF-beta-4; LEFTY2; EBAF; LEFTA; LEFTYA; TGFB4
AA Sequence

LTEEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQYVVLLRRSHGDRSRGKHHHHHH&FSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP

Molecular Weight

45-50 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Histidine-HCl, 4% Sucrose, 4% Mannitol, 0.1% Tween80, pH 6.0 or 20 mM His-HCl, 10% Trehalose, 4% Mannitol, 100 mM NaCl, 0.1% Tween 80, pH 5.5 or PBS, pH 7.0, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Lefty-A/TGF-beta 4 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Lefty-A/TGF-beta 4 Protein, Human (HEK293, His)
Cat. No.:
HY-P70191
Quantity:
MCE Japan Authorized Agent: