Lefty-A/TGF-beta 4 Protein, Human (HEK293, His)

Lefty-A, or TGF-beta 4, plays a crucial role in determining left-right (L-R) asymmetry in mammalian organ systems. Its implication in endometrial bleeding suggests a potential role in reproductive processes, highlighting its significance beyond embryonic development. Lefty-A/TGF-beta 4 Protein, Human (HEK293, His) is the recombinant human-derived Lefty-A/TGF-beta 4 protein, expressed by HEK293 , with N-6*His labeled tag.

Lefty-A, also known as TGF-beta 4, is crucial for the determination of left-right (L-R) asymmetry in organ systems within mammals. Its involvement in endometrial bleeding suggests a potential role in reproductive processes, emphasizing its significance beyond embryonic development.

1.Measured by its ability to induce cell death using Mv1Lu mink lung epithelial cells. The ED₅₀ for this effect is 0.9733-2.015 μg/mL. 2.Measured by its ability to induce cell death using Mv1Lu mink lung epithelial cells. The ED₅₀ for this effect is 1.805 μg/mL, corresponding to a specific activity is 554.017 units/mg.

• 
  Measured by its ability to induce cell death using Mv1Lu mink lung epithelial cells. The ED₅₀ for this effect is 0.9733 μg/mL, corresponding to a specific activity is 1.027×10³ units/mg.

Human

HEK293

N-6*His

O00292 (L22-K76) & O00292 (F78-P366)

7044  [NCBI]

LTEEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQYVVLLRRSHGDRSRGKHHHHHH&FSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSAQARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLRDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAKNWVLEPPGFLAYECVGTCQQPPEALAFNWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP

45-50 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Histidine-HCl, 4% Sucrose, 4% Mannitol, 0.1% Tween80, pH 6.0 or 20 mM His-HCl, 10% Trehalose, 4% Mannitol, 100 mM NaCl, 0.1% Tween 80, pH 5.5 or PBS, pH 7.0, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.