LOX-1/OLR1 Protein, Rat (HEK293, His)

The LOX-1/OLR1 protein plays an important role as a receptor that recognizes, internalizes, and degrades oxidatively modified low-density lipoprotein (oxLDL), a marker of atherosclerosis, in vascular endothelial cells. OxLDL induces endothelial dysfunction, triggering pro-inflammatory responses, oxidative conditions, and apoptosis. LOX-1/OLR1 Protein, Rat (HEK293, His) is the recombinant rat-derived LOX-1/OLR1 protein, expressed by HEK293 , with N-His labeled tag. The total length of LOX-1/OLR1 Protein, Rat (HEK293, His) is 305 a.a., with molecular weight of 43-47 kDa.

LOX-1/OLR1 Protein functions as a receptor that plays a crucial role in the recognition, internalization, and degradation of oxidatively modified low-density lipoprotein (oxLDL) by vascular endothelial cells. OxLDL, a marker of atherosclerosis, induces endothelial cell activation and dysfunction, leading to pro-inflammatory responses, pro-oxidative conditions, and apoptosis. The association with oxLDL triggers the activation of NF-kappa-B, resulting in increased intracellular reactive oxygen species production and various pro-atherogenic cellular responses, including reduced nitric oxide release, monocyte adhesion, and apoptosis. Beyond its role in lipid metabolism, LOX-1/OLR1 acts as a receptor for HSP70, facilitating antigen cross-presentation to naive T-cells in dendritic cells and participating in cell-mediated antigen cross-presentation. Moreover, it is involved in inflammatory processes, acting as a leukocyte-adhesion molecule at the vascular interface during endotoxin-induced inflammation. Additionally, LOX-1/OLR1 serves as a receptor for advanced glycation end products, activated platelets, monocytes, apoptotic cells, and both Gram-negative and Gram-positive bacteria. It forms homodimers, potentially organizing into hexamers composed of three homodimers, and interacts with HSP70.

Measured by its binding ability in a functional ELISA. Immobilized Rat LOX-1 at 5 μg/mL (100 μL/well) can bind AGE-BSA, The ED₅₀ for this effect is 0.724 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Rat LOX-1 at 5 μg/mL (100 μL/well) can bind AGE-BSA, The ED₅₀ for this effect is 0.724 μg/mL.

Rat

HEK293

C-6*His

O70156 (L60-Q364)

140914  [NCBI]

LQVSDLLKQYQANLTQQDHILEGQMSAQKKAENASQESKRELKEQIDTLTWKLNEKSKEQEKLLQQNQNLQEALQRAVNASEESKWELKEQIDILNWKLNGISKEQKELLQQNQNLQEALQKAEKYSEESQRELKEQIDTLSWKLNEKSKEQEELLQQNQNLQEALQRAANSSGPCPQDWIWHKENCYLFHGPFNWEKSRENCLSLDAQLLQISTTDDLNFVLQATSHSTSPFWMGLHRKNPNHPWLWENGSPLSFQFFRTRGVSLQMYSSGTCAYIQGGVVFAENCILTAFSICQKKANLLLTQ

Approximately 38-55 kDa due to the glycosylation

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.