1. Recombinant Proteins
  2. Others
  3. Lymphocyte antigen 6A-2/LY6A Protein, Mouse (His)

Lymphocyte antigen 6A-2/LY6A Protein, Mouse (His)

Cat. No.: HY-P75920
SDS COA Handling Instructions Technical Support

Lymphocyte antigen 6A-2/LY6A Protein, crucial for T-cell activation, plays a key role in immune responses. Its ability to facilitate T-cell activation underscores its importance in regulating T-cell responses and immune surveillance. The molecular interactions and signaling pathways in which LY6A participates during T-cell activation highlight its significance as a key orchestrator in immune responses, contributing to immune homeostasis. Lymphocyte antigen 6A-2/LY6A Protein, Mouse (His) is the recombinant mouse-derived Lymphocyte antigen 6A-2/LY6A protein, expressed by E. coli , with N-His labeled tag. The total length of Lymphocyte antigen 6A-2/LY6A Protein, Mouse (His) is 93 a.a., with molecular weight of ~10.9 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Lymphocyte antigen 6A-2/LY6A Protein, crucial for T-cell activation, plays a key role in immune responses. Its ability to facilitate T-cell activation underscores its importance in regulating T-cell responses and immune surveillance. The molecular interactions and signaling pathways in which LY6A participates during T-cell activation highlight its significance as a key orchestrator in immune responses, contributing to immune homeostasis. Lymphocyte antigen 6A-2/LY6A Protein, Mouse (His) is the recombinant mouse-derived Lymphocyte antigen 6A-2/LY6A protein, expressed by E. coli , with N-His labeled tag. The total length of Lymphocyte antigen 6A-2/LY6A Protein, Mouse (His) is 93 a.a., with molecular weight of ~10.9 kDa.

Background

Lymphocyte antigen 6A-2/LY6A protein is characterized by its role in T-cell activation, signifying its involvement in pivotal immune responses. The protein's capacity to facilitate T-cell activation highlights its importance in mediating key events in the immune system, potentially contributing to the regulation of T-cell responses and immune surveillance. The specific molecular interactions and signaling pathways in which LY6A participates during T-cell activation underscore its significance as a key player in orchestrating immune responses and maintaining immune homeostasis.

Species

Mouse

Source

E. coli

Tag

N-His

Accession

P05533 (L27-G119)

Gene ID

110454  [NCBI]

Molecular Construction
N-term
His
LY6A (L27-G119)
Accession # P05533
C-term
Synonyms
Lymphocyte antigen 6A-2/6E-1; Ly-6A.2/Ly-6E.1; SCA-1; TAP; Ly6
AA Sequence

LECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLCNVAVPNGGSTWTMAG

Molecular Weight

Approximately 10.9 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris, 0.2 M NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Lymphocyte antigen 6A-2/LY6A Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Lymphocyte antigen 6A-2/LY6A Protein, Mouse (His)
Cat. No.:
HY-P75920
Quantity:
MCE Japan Authorized Agent: