1. Recombinant Proteins
  2. Others
  3. LYG2 Protein, Human (HEK293, His)

LYG2 Protein emerges as a potent antibacterial agent, indicating a pivotal role in innate immunity. Its putative capacity as an antibacterial protein suggests active participation in the host's defense against bacterial threats. LYG2's role underscores its significance as a key player in the early lines of defense, reflecting its potential contribution to the body's ability to counteract bacterial infections. LYG2 Protein, Human (HEK293, His) is the recombinant human-derived LYG2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LYG2 Protein, Human (HEK293, His) is 193 a.a., with molecular weight of 23-27 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LYG2 Protein emerges as a potent antibacterial agent, indicating a pivotal role in innate immunity. Its putative capacity as an antibacterial protein suggests active participation in the host's defense against bacterial threats. LYG2's role underscores its significance as a key player in the early lines of defense, reflecting its potential contribution to the body's ability to counteract bacterial infections. LYG2 Protein, Human (HEK293, His) is the recombinant human-derived LYG2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LYG2 Protein, Human (HEK293, His) is 193 a.a., with molecular weight of 23-27 kDa.

Background

The LYG2 protein emerges as a potent antibacterial entity, suggesting a potential pivotal role in innate immunity. With its putative capacity as an antibacterial protein, LYG2 implies active participation in the host's defense mechanisms against bacterial threats. The protein's role in innate immunity underscores its significance as a key player in the early lines of defense, reflecting its potential contribution to the body's ability to counteract bacterial infections.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q86SG7-1 (S20-F212)

Gene ID
Molecular Construction
N-term
LYG2 (S20-F212)
Accession # Q86SG7-1
6*His
C-term
Synonyms
Lysozyme G-Like Protein 2; LYG2; LYGH
AA Sequence

SYPFSHSMKPHLHPRLYHGCYGDIMTMKTSGATCDANSVMNCGIRGSEMFAEMDLRAIKPYQTLIKEVGQRHCVDPAVIAAIISRESHGGSVLQDGWDHRGLKFGLMQLDKQTYHPVGAWDSKEHLSQATGILTERIKAIQKKFPTWSVAQHLKGGLSAFKSGIEAIATPSDIDNDFVNDIIARAKFYKRQSF

Molecular Weight

23-27 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

LYG2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LYG2 Protein, Human (HEK293, His)
Cat. No.:
HY-P70868
Quantity:
MCE Japan Authorized Agent: