1. Recombinant Proteins
  2. Others
  3. Lymphocyte antigen 6G/LY6G Protein, Mouse (P.pastoris)

Lymphocyte antigen 6G/LY6G Protein, Mouse (P.pastoris)

Cat. No.: HY-P71801
SDS COA Handling Instructions Technical Support

Lymphocyte antigen 6G/LY6G protein is uniquely expressed in bone marrow, indicating its involvement in the hematopoietic microenvironment. This suggests a role in regulating immune cell development or function within the bone marrow niche. Lymphocyte antigen 6G/LY6G Protein, Mouse (P.pastoris) is the recombinant mouse-derived Lymphocyte antigen 6G/LY6G protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Lymphocyte antigen 6G/LY6G Protein, Mouse (P.pastoris) is 93 a.a., with molecular weight (glycosylation form) of ~34 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Lymphocyte antigen 6G/LY6G protein is uniquely expressed in bone marrow, indicating its involvement in the hematopoietic microenvironment. This suggests a role in regulating immune cell development or function within the bone marrow niche. Lymphocyte antigen 6G/LY6G Protein, Mouse (P.pastoris) is the recombinant mouse-derived Lymphocyte antigen 6G/LY6G protein, expressed by P. pastoris , with N-6*His labeled tag. The total length of Lymphocyte antigen 6G/LY6G Protein, Mouse (P.pastoris) is 93 a.a., with molecular weight (glycosylation form) of ~34 kDa.

Background

Lymphocyte antigen 6G/LY6G protein is specifically expressed in the bone marrow. This localization underscores its involvement in the hematopoietic microenvironment and suggests a potential role in regulating immune cell development or function within the bone marrow niche. The restricted expression pattern of LY6G to this particular tissue implies its specificity in contributing to hematopoietic processes, reflecting its significance in the context of immune cell homeostasis or response mechanisms within the bone marrow microenvironment.

Species

Mouse

Source

P. pastoris

Tag

N-6*His

Accession

P35461 (L27-G119)

Gene ID

546644  [NCBI]

Molecular Construction
N-term
6*His
LY6G (L27-G119)
Accession # P35461
C-term
Synonyms
Ly6g; Lymphocyte antigen 6G; Ly-6G; Ly-6G.1
AA Sequence

LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAG

Molecular Weight

Approximately 34 kDa.The reducing (R) protein migrat es as 34 kDa in SDS-PAGE may be due to glycosylation.

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Lymphocyte antigen 6G/LY6G Protein, Mouse (P.pastoris) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Lymphocyte antigen 6G/LY6G Protein, Mouse (P.pastoris)
Cat. No.:
HY-P71801
Quantity:
MCE Japan Authorized Agent: