1. Recombinant Proteins
  2. Others
  3. LYPD3/C4.4A Protein, Mouse (HEK293, His)

The LYPD3/C4.4A protein is a multifunctional cell surface molecule that is critical for cell migration and has been implicated in potential tumor progression. It binds laminin 1 and laminin 5, emphasizing its role in extracellular matrix interactions. LYPD3/C4.4A Protein, Mouse (HEK293, His) is the recombinant mouse-derived LYPD3/C4.4A protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The LYPD3/C4.4A protein is a multifunctional cell surface molecule that is critical for cell migration and has been implicated in potential tumor progression. It binds laminin 1 and laminin 5, emphasizing its role in extracellular matrix interactions. LYPD3/C4.4A Protein, Mouse (HEK293, His) is the recombinant mouse-derived LYPD3/C4.4A protein, expressed by HEK293 , with C-His labeled tag.

Background

LYPD3/C4.4A protein, a versatile cell surface molecule, plays a crucial role in supporting cell migration and is implicated in potential contributions to tumor progression. This protein exhibits binding affinity for laminin-1 and laminin-5, highlighting its involvement in interactions with extracellular matrix components. Additionally, LYPD3/C4.4A interacts with LGALS3, suggesting a role in cellular processes influenced by galectin interactions. Furthermore, its association with AGR2 and AGR3 implies potential involvement in pathways related to tumor development and progression. The multifaceted interactions of LYPD3/C4.4A underscore its significance in cellular dynamics and its potential impact on pathological processes, particularly in the context of tumor biology.

Biological Activity

Measured by its binding ability in a functional ELISA. When LYPD3 is immobilized at 0.5 μg/mL (100 μL/well), Galectin-3 binds with an apparent KD is 109.3nM.

  • Measured by its binding ability in a functional ELISA. When LYPD3 is immobilized at 0.5 μg/mL (100 μL/well), Galectin-3 binds with an apparent KD is 109.3 nM.
Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q91YK8 (L33-H287)

Gene ID
Molecular Construction
N-term
LYPD3 (L33-H287)
Accession # Q91YK8
His
C-term
Synonyms
Ly6/PLAUR domain-containing protein 3; GPI-anchored metastasis-associated protein C4.4A homolog
AA Sequence

LECYSCVQKADDGCSPHRMKTVKCGPGVDVCTEAVGAVETIHGQFSVAVRGCGSGIPGKNDRGLDLHGLLAFFQLQQCSEDRCNAKLNLTLRGLNPAGNESAYEPNGAECYSCVGLSREKCQGSMPPVVNCYNASGRVYKGCFDGNVTLTAANVTVSLPVRGCVQDETCTRDGVTGPGFTLSGSCCQGPRCNADLRNKTYFSPRIPPLVLLPPPTTAAPSTRAQNSSSTTSTAAPTTTTSIIKPTTAQASHTSPH

Molecular Weight

The protein migrates as approximately 45-75 kDa under reducing SDS-PAGE due to glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LYPD3/C4.4A Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LYPD3/C4.4A Protein, Mouse (HEK293, His)
Cat. No.:
HY-P76483
Quantity:
MCE Japan Authorized Agent: