1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. M-CSF
  5. M-CSF Protein, Human (Tag free, HEK293)

The M-CSF protein is an important cytokine that modulates hematopoietic precursor cells, especially mononuclear phagocytes, affecting innate immunity and inflammation through the release of proinflammatory chemokines. It is essential for osteoclast proliferation and regulates bone resorption, bone development and fertility. M-CSF Protein, Human (Tag free, HEK293) is the recombinant human-derived M-CSF protein, expressed by HEK293 , with tag free. The total length of M-CSF Protein, Human (Tag free, HEK293) is 158 a.a., with molecular weight (glycosylation form) of 23-28 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
20 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time
100 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The M-CSF protein is an important cytokine that modulates hematopoietic precursor cells, especially mononuclear phagocytes, affecting innate immunity and inflammation through the release of proinflammatory chemokines. It is essential for osteoclast proliferation and regulates bone resorption, bone development and fertility. M-CSF Protein, Human (Tag free, HEK293) is the recombinant human-derived M-CSF protein, expressed by HEK293 , with tag free. The total length of M-CSF Protein, Human (Tag free, HEK293) is 158 a.a., with molecular weight (glycosylation form) of 23-28 kDa.

Background

M-CSF Protein is a vital cytokine involved in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes like macrophages and monocytes. It plays a crucial role in innate immunity and inflammatory processes by promoting the release of pro-inflammatory chemokines. Additionally, M-CSF Protein is essential for osteoclast proliferation and differentiation, regulating bone resorption, and normal bone development. It is also necessary for normal male and female fertility. Moreover, M-CSF Protein contributes to the reorganization of the actin cytoskeleton, facilitating membrane ruffle formation, cell adhesion, and cell migration. Furthermore, it plays a role in lipoprotein clearance. M-CSF Protein can exist in different forms, such as homodimer or heterodimer configurations, and it interacts with CSF1R.

Species

Human

Source

HEK293

Tag

Tag Free

Accession

P09603-1 (E33-N190)

Gene ID

1435

Molecular Construction
N-term
M-CSF (E33-N190)
Accession # P09603-1
C-term
Synonyms
Macrophage Colony-Stimulating Factor 1; CSF-1; M-CSF; Lanimostim
AA Sequence

EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCN

Molecular Weight

23-28 kDa, due to glycosylation

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

< 1 EU/μg of protein by gel clotting method

Documentation

M-CSF Protein, Human (Tag free, HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
M-CSF Protein, Human (Tag free, HEK293)
Cat. No.:
HY-P701251
Quantity:
MCE Japan Authorized Agent: