M-CSF Protein, Human (Tag free, HEK293)

The M-CSF protein is an important cytokine that modulates hematopoietic precursor cells, especially mononuclear phagocytes, affecting innate immunity and inflammation through the release of proinflammatory chemokines. It is essential for osteoclast proliferation and regulates bone resorption, bone development and fertility. M-CSF Protein, Human (Tag free, HEK293) is the recombinant human-derived M-CSF protein, expressed by HEK293 , with tag free. The total length of M-CSF Protein, Human (Tag free, HEK293) is 158 a.a., with molecular weight (glycosylation form) of 23-28 kDa.

M-CSF Protein is a vital cytokine involved in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes like macrophages and monocytes. It plays a crucial role in innate immunity and inflammatory processes by promoting the release of pro-inflammatory chemokines. Additionally, M-CSF Protein is essential for osteoclast proliferation and differentiation, regulating bone resorption, and normal bone development. It is also necessary for normal male and female fertility. Moreover, M-CSF Protein contributes to the reorganization of the actin cytoskeleton, facilitating membrane ruffle formation, cell adhesion, and cell migration. Furthermore, it plays a role in lipoprotein clearance. M-CSF Protein can exist in different forms, such as homodimer or heterodimer configurations, and it interacts with CSF1R.

Human

HEK293

Tag Free

P09603-1 (E33-N190)

1435

EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCN

23-28 kDa, due to glycosylation

Greater than 95% as determined by reducing SDS-PAGE.

< 1 EU/μg of protein by gel clotting method