1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Isomerases (EC 5)
  4. Maleylacetoacetate isomerase/GSTZ1 Protein, Human (N-His)

Maleylacetoacetate isomerase/GSTZ1 Protein, Human (N-His)

Cat. No.: HY-P70206A
Handling Instructions Technical Support

The maleylacetoacetate isomerase/GSTZ1 protein is a member of the GST superfamily and detoxifies electrophilic molecules. It converts maleylacetoacetate to fumarylacetoacetate, a key step in phenylalanine/tyrosine degradation. Maleylacetoacetate isomerase/GSTZ1 Protein, Human (N-His) is the recombinant human-derived Maleylacetoacetate isomerase/GSTZ1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of Maleylacetoacetate isomerase/GSTZ1 Protein, Human (N-His) is 215 a.a., with molecular weight of ~25 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The maleylacetoacetate isomerase/GSTZ1 protein is a member of the GST superfamily and detoxifies electrophilic molecules. It converts maleylacetoacetate to fumarylacetoacetate, a key step in phenylalanine/tyrosine degradation. Maleylacetoacetate isomerase/GSTZ1 Protein, Human (N-His) is the recombinant human-derived Maleylacetoacetate isomerase/GSTZ1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of Maleylacetoacetate isomerase/GSTZ1 Protein, Human (N-His) is 215 a.a., with molecular weight of ~25 kDa.

Background

The Maleylacetoacetate isomerase/GSTZ1 protein belongs to the glutathione S-transferase (GSTs) superfamily, encoding multifunctional enzymes that play a crucial role in the detoxification of electrophilic molecules, including carcinogens, mutagens, and therapeutic drugs, through conjugation with glutathione. This enzyme specifically catalyzes the conversion of maleylacetoacetate to fumarylacetoacatate, a critical step in the phenylalanine/tyrosine degradation pathway. In mice, deficiency of a similar gene leads to oxidative stress. The gene exhibits several transcript variants that encode multiple protein isoforms. Furthermore, the Maleylacetoacetate isomerase/GSTZ1 protein displays broad expression in the liver (RPKM 23.8), testis (RPKM 10.9), and 24 other tissues.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

NP_665877.1 (Q2-A216)

Gene ID
Molecular Construction
N-term
6*His
GSTZ1 (Q2-A216)
Accession # NP_665877.1
C-term
Synonyms
rHuMaleylacetoacetate isomerase/GSTZ1, His; Maleylacetoacetate Isomerase; MAAI; GSTZ1-1; Glutathione S-Transferase Zeta 1; GSTZ1
AA Sequence

QAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA

Molecular Weight

Approximately 25 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl,500 mM arginine, pH 7.4, 5% trehalose,5% mannitol and 0.01% Tween80.

Endotoxin Level

Data is not available.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For lower concentration, please reconstitute in 50mM Tris-HCL,300mM NaCl,500mM arginine,pH 7.4 buffer.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Maleylacetoacetate isomerase/GSTZ1 Protein, Human (N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Maleylacetoacetate isomerase/GSTZ1 Protein, Human (N-His)
Cat. No.:
HY-P70206A
Quantity:
MCE Japan Authorized Agent: