1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. CCL22
  6. MDC/CCL22 Protein, Rat

CCL22/MDC Protein, Rat is a CC chemokine that acts as a ligand for the CCR4 receptor and is a chemoattractant for CCR4-expressing cells such as Th2 cells, playing an important role in homeostatic and inflammatory responses. CCL22/MDC Protein, Rat is a recombinant rat CCL22/MDC(G25-A92) protein expressed by E. coli.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CCL22/MDC Protein, Rat is a CC chemokine that acts as a ligand for the CCR4 receptor and is a chemoattractant for CCR4-expressing cells such as Th2 cells, playing an important role in homeostatic and inflammatory responses. CCL22/MDC Protein, Rat is a recombinant rat CCL22/MDC(G25-A92) protein expressed by E. coli[1][2].

Background

CCL22, also known as macrophage-derived chemokine (MDC), a CC chemokine located on chromosome 16 in the human genome, is a protein encoded by the CCL22 gene that shares 37% identity with CCL17 at the amino acid level. CCL22 is secreted by dendritic cells and macrophages and can be upregulated by a variety of stimulatory factors, such as lipopolysaccharides, cytokines. Among them, the Th2 cytokines IL-4 and IL-13 induce CCL22 production in myeloid cells and can be inhibited by the Th1 cytokine IFN-γ. In addition to acting as a potent chemotactic agent for CCR4-expressing Th2 lymphocytes, monocytes, monocyte-derived dendritic cells, and natural killer cells, CCL22 can also affect its target cells by interacting with the chemokine receptor CCR4. CCL22 is a potent inducer of CCR4 internalization, and CCL22 binding to CCR4 reduces the subsequent functional response of CCR4. The interaction of CCL22 with CCR4 is involved in a variety of pathologies, ranging from allergic reactions and autoimmunity to tumor growth. In contrast, small molecule compounds and antibodies capable of blocking CCL17 and CCL22-mediated recruitment of Th2 and Treg cells have been shown to have positive effects in various disease models of asthma, atopic disease and tumor growth. In addition, an important role of CCL22 and its receptors in TH2 lymphocyte recruitment has been shown in models of allergic airway inflammation. It can also be involved in thymopoiesis by regulating the migration of mature thymocytes through this organ[1][2].

In Vivo

CCL22 expression is selectively upregulated in the rat model of radiation pneumonia/pulmonary fibrosis, and increased CCL22 expression is also observed in some alveolar macrophages in the lungs of the radiotherapy group[3].

Species

Rat

Source

E. coli

Tag

Tag Free

Accession

Q5I0L5 (G25-A92)

Gene ID
Molecular Construction
N-term
MDC (G25-A92)
Accession # Q5I0L5
C-term
Synonyms
rRtMDC/CCL22; C-C motif chemokine 22; Abcd1; SCYA22
AA Sequence

GPYGANVEDSICCQDYIRHPLPPRFVKEFYWTSKSCRKPGVVLITIKNRDICADPRMLWVKKILHKLA

Molecular Weight

Approximately 7.9 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

MDC/CCL22 Protein, Rat Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MDC/CCL22 Protein, Rat
Cat. No.:
HY-P7249
Quantity:
MCE Japan Authorized Agent: