Melanotransferrin/CD228 Protein, Mouse (HEK293, His)

Melanotransferrin/CD228 protein is involved in cellular iron uptake, undergoing internalization and recycling to the cell membrane. Each subunit binds a single iron atom, suggesting a role in intracellular iron transport. Melanotransferrin/CD228 also exhibits potential zinc binding, showcasing versatile metal ion interactions. Melanotransferrin/CD228 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Melanotransferrin/CD228 protein, expressed by HEK293 , with C-His labeled tag.

Melanotransferrin/CD228 protein is implicated in cellular iron uptake, where it appears to undergo internalization and subsequent recycling back to the cell membrane. Each subunit of this protein has the capacity to bind a single atom of iron, suggesting its role in intracellular iron transport. Additionally, Melanotransferrin/CD228 could potentially bind zinc, indicating a versatility in metal ion binding capabilities.

Measured in a cell proliferation assay using SH-SY5Y cells. The ED₅₀ for this effect is 1.088 μg/mL, corresponding to a specific activity is 919.118 units/mg.

• 
  Measured in a cell proliferation assay using SH-SY5Y cells. The ED₅₀ for this effect is 1.088 μg/mL, corresponding to a specific activity is 919.118 units/mg.

Mouse

HEK293

C-10*His

Q9R0R1 (V20-Q708)

30060  [NCBI]

VMEVQWCTISDAEQQKCKDMSEAFQGAGIRPSLLCVQGNSADHCVQLIKEQKADAITLDGGAIYEAGKEHGLKPVVGEVYDQDIGTSYYAVAVVRRNSNVTINTLKGVKSCHTGINRTVGWNVPVGYLVESGHLSVMGCDVLKAVGDYFGGSCVPGTGETSHSESLCRLCRGDSSGHNVCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDGNTLPSWGKSLMSEDFQLLCRDGSRADITEWRRCHLAKVPAHAVVVRGDMDGGLIFQLLNEGQLLFSHEDSSFQMFSSKAYSQKNLLFKDSTLELVPIATQNYEAWLGQEYLQAMKGLLCDPNRLPHYLRWCVLSAPEIQKCGDMAVAFSRQNLKPEIQCVSAESPEHCMEQIQAGHTDAVTLRGEDIYRAGKVYGLVPAAGELYAEEDRSNSYFVVAVARRDSSYSFTLDELRGKRSCHPYLGSPAGWEVPIGSLIQRGFIRPKDCDVLTAVSQFFNASCVPVNNPKNYPSALCALCVGDEKGRNKCVGSSQERYYGYSGAFRCLVEHAGDVAFVKHTTVFENTNGHNPEPWASHLRWQDYELLCPNGARAEVDQFQACNLAQMPSHAVMVRPDTNIFTVYGLLDKAQDLFGDDHNKNGFQMFDSSKYHSQDLLFKDATVRAVPVREKTTYLDWLGPDYVVALEGMLSQQ

Approximately 80 kDa due to the glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.