MGMT Protein, Human (His)

MGMT Protein crucially defends against O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA, using a suicide reaction to repair methylated nucleobases. It stoichiometrically transfers the methyl group to a cysteine residue, but this process irreversibly inactivates MGMT. The sacrificial nature of MGMT's function emphasizes its commitment to safeguarding cellular DNA integrity at the expense of its own activity. MGMT Protein, Human (His) is the recombinant human-derived MGMT protein, expressed by E. coli , with N-6*His labeled tag. The total length of MGMT Protein, Human (His) is 207 a.a., with molecular weight of ~27.0 kDa.

The MGMT Protein plays a crucial role in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA. Operating through a suicide reaction, MGMT repairs the methylated nucleobases in DNA by stoichiometrically transferring the methyl group to a cysteine residue within the enzyme. However, this repair process results in the irreversible inactivation of the MGMT Protein. This unique mechanism underscores the sacrificial nature of MGMT's function, emphasizing its commitment to safeguarding cellular DNA integrity at the expense of its own activity.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His

P16455 (M1-N207)

4255  [NCBI]

MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN

Approximately 26.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl,1 mM DTT,1 mM EDTA,500 mM NaCl,0.1% Trition X-100, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.