MIF Protein, Human (N-His, C-Myc)

The MIF protein is a pro-inflammatory cytokine that is critical for the innate immune response against bacterial pathogens. Its presence at sites of inflammation suggests a role in modulating macrophage function to promote host defense. MIF counteracts the anti-inflammatory effects of glucocorticoids. Although MIF exhibits tautomerase activity in vitro, its physiological substrates remain unknown, and the relevance of this activity to its cytokine function is unclear. MIF Protein, Human (N-His, C-Myc) is the recombinant human-derived MIF protein, expressed by E. coli, with C-Myc, N-10*His labeled tag. The total length of MIF Protein, Human (N-His, C-Myc) is 114 a.a., with molecular weight of 17.1 kDa.

MIF Protein is a pro-inflammatory cytokine that plays a crucial role in the innate immune response against bacterial pathogens. Its expression at sites of inflammation suggests its involvement in regulating macrophage function in host defense. MIF counteracts the anti-inflammatory effects of glucocorticoids. Although MIF has phenylpyruvate tautomerase and dopachrome tautomerase activity in vitro, the physiological substrate of MIF is still unknown. It remains unclear whether the tautomerase activity is relevant to its cytokine activity.

Human

E. coli

C-Myc;N-10*His

P14174 (P2-A115)

4282  [NCBI]

PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

17.1 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.