MMP-1 Protein, Human (HEK293, C-His)

The MMP-1 protein acts as an enzyme capable of cleaving types I, II, and III collagen at specific sites within the helical domain. In addition, it exhibits lytic activity against type VII and type X collagen. MMP-1 Protein, Human (HEK293, C-His) is the recombinant human-derived MMP-1, expressed by HEK293 , with C-6*His labeled tag. ,

Matrix metalloproteinase-1 (MMP-1) is a proteolytic enzyme known for its role in extracellular matrix remodeling. It exhibits a broad substrate specificity, cleaving collagens of types I, II, and III at a specific site within the helical domain. Additionally, MMP-1 demonstrates activity against collagens of types VII and X. Notably, in the context of HIV infection, MMP-1 interacts with and cleaves the secreted viral Tat protein, resulting in a decrease in neuronal Tat-mediated neurotoxicity. This interaction underscores the diverse functions of MMP-1 beyond its canonical role in extracellular matrix degradation, implicating it in processes associated with viral infection and neuroprotection (

Measured by its ability to cleave 20µM fluorogenic peptide substrate, Mca-KPLGL-Dpa-AR-NH2 that incubate at room temperature in kinetic mode for 5 minutes. The specific activity is 14713.15 pmol/min/µg, as measured under the described conditions. (Activation description: The proenzyme needs to be activated by APMA for an activated form).

Human

HEK293

C-6*His

P03956 (F20-N469)

4312

FPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN

Approximately 56 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.