1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. MSRB3 Protein, Human (HEK293, His)

MSRB3 Protein, with a unique ability to catalyze methionine sulfoxide reduction, plays a crucial role in the auditory system. Isoform 2 of MSRB3 is deemed essential for normal hearing, highlighting its significance in auditory function. MSRB3 Protein, Human (HEK293, His) is the recombinant human-derived MSRB3 protein, expressed by HEK293 , with C-His labeled tag. The total length of MSRB3 Protein, Human (HEK293, His) is 156 a.a., with molecular weight of ~18.4 KDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MSRB3 Protein, with a unique ability to catalyze methionine sulfoxide reduction, plays a crucial role in the auditory system. Isoform 2 of MSRB3 is deemed essential for normal hearing, highlighting its significance in auditory function. MSRB3 Protein, Human (HEK293, His) is the recombinant human-derived MSRB3 protein, expressed by HEK293 , with C-His labeled tag. The total length of MSRB3 Protein, Human (HEK293, His) is 156 a.a., with molecular weight of ~18.4 KDa.

Background

MSRB3, a protein with the distinctive ability to catalyze the reduction of both free and protein-bound methionine sulfoxide to methionine, stands out for its crucial role in the auditory system. Specifically, isoform 2 of MSRB3 is deemed essential for normal hearing, underscoring its significance in auditory function.

Biological Activity

Measured by its ability to through oxidizing DTT. The specific activity is 17261.04 pmoL/min/μg, as measured under the described conditions.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q8IXL7-2 (G26-D181)

Gene ID
Molecular Construction
N-term
MSRB3 (G26-D181)
Accession # Q8IXL7-2
His
C-term
Synonyms
Methionine-R-sulfoxide reductase B3; MSRB3
AA Sequence

GSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQAD

Molecular Weight

Approximately 19 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MSRB3 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MSRB3 Protein, Human (HEK293, His)
Cat. No.:
HY-P76501
Quantity:
MCE Japan Authorized Agent: