Nectin-2/CD112 Protein, Cynomolgus (HEK293, His)

Nectin-2, a poliovirus receptor-related 2 protein, is a type I transmembrane glycoprotein and a member of the Ig gene superfamily. Nectin-2, also known as CD112, is an adhesion molecule involved in the formation of cell junctions and interactions with other Nectin-family molecules. Nectin-2/CD112 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Nectin-2/CD112 protein, expressed by HEK293 , with C-His labeled tag.

Nectin-2, a poliovirus receptor-related 2 protein, is a type I transmembrane glycoprotein and a member of the Ig gene superfamily. Nectin-2, also known as CD112, is an adhesion molecule involved in the formation of cell junctions and interactions with other Nectin-family molecules. Nectin-2 enables cell adhesion molecule binding. Nectin-2 is involved in acrosome assembly, fusion of virus membrane with host plasma membrane and positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target^[1][2].

Measured by its binding ability in a functional ELISA. When Recombinant Cynomolgus Nectin-2/CD112 is immobilized at 0.5 µg/mL (100 µL/well), Recombinant Cynomolgus DNAM-1/CD226 binds with an ED₅₀ of 0.5776 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Cynomolgus Nectin-2/CD112 is immobilized at 0.5 µg/mL (100 µL/well), Recombinant Cynomolgus DNAM-1/CD226 binds with an ED₅₀ of 0.5776 μg/mL.

Cynomolgus

HEK293

C-His

Q0MSE5/NP_001037058.1 (Q32-L360)

713229  [NCBI]

QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPPDHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTRQDTEAELQDATLALRGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPQNHAEAQEVTFSQDPVPVARCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVHSNPEPTGYDWSTTSGIFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDMGPL

Approximately 47 kDa due to the glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.