Neuroserpin Protein, Human (CHO)

Neuroserpin Protein, Human (CHO) is a member of the serpin family of serine protease inhibitors, playing an important role in synaptic plasticity and memory formation in the hippocampus.

Neuroserpin is a member of the serpin family of serine protease inhibitors predominantly expressed in the nervous system. Neuroserpin plays an important role in synaptic plasticity and memory formation in the hippocampus. Neuroserpin expression is particularly prominent at late stages of neuronal development in most regions of the central nervous system (CNS), whereas it is restricted to regions related to learning and memory in the adult brain^[1].

The ED₅₀ determined by a cell proliferation assay using rat C6 cells. The ED50 for this effect is ≤ 2.218 μg/mL, corresponding to a specific activity of ≥ 450.857 units/mg.

• 
  The ED₅₀ as determined by a cell proliferation assay using rat C6 cells. The ED₅₀ for this effect is 2.218 μg/mL, corresponding to a specific activity is 450.857 units/mg.

Human

CHO

Tag Free

Q99574 (T17-L410)

5274  [NCBI]

TGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEG

40-45 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS or 20 mM PB, 150 mM NaCl, pH 7.4.

< 0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Reumann R, et al. The serine protease inhibitor neuroserpin is required for normal synaptic plasticity and regulates learning and social behavior. Learn Mem. 2017 Nov 15;24(12):650-659.  [Content Brief]