Noggin Protein, Mouse (HEK293, Fc)

Noggin is an indispensable factor in cartilage morphogenesis and joint formation, a potent inhibitor of bone morphogenetic protein (BMP) signaling, and plays a crucial role in the growth and patterning of the neural tube and somites.By forming homodimers, Noggin acts as a key regulator to inhibit chondrocyte differentiation by interacting with growth and differentiation factors, particularly GDF5 and possibly GDF6.Noggin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Noggin protein, expressed by HEK293 , with C-hFc labeled tag.

Noggin is a vital protein involved in cartilage morphogenesis and joint formation, playing a crucial role in inhibiting bone morphogenetic proteins (BMP) signaling essential for the growth and patterning of the neural tube and somite. Acting as an inhibitor of BMP, Noggin is implicated in the regulation of chondrocyte differentiation through its interaction with growth and differentiation factor 5 (GDF5) and likely GDF6. Existing as a homodimer, Noggin directly interacts with GDF5, leading to the inhibition of chondrocyte differentiation. These multifaceted functions underscore the importance of Noggin in embryonic development, particularly in the intricate processes of skeletal and neural tissue formation, and highlight its role as a key modulator of BMP signaling pathways (

Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED₅₀ for this effect is 0.04-0.3 µg/mL in the presence of 50 ng/mL of recombinant Human BMP‑4.

Mouse

HEK293

C-hFc

P97466 (Q28-C232)

18121  [NCBI]

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

55-65 kDa

Greater than 90% as determined by Tris-Bis PAGE.

Lyophilized powder.

Lyophilized from 0.22μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.