Norrin Protein, Human

Norrin protein activates canonical Wnt signaling by binding to FZD4 and LRP5, promotes retinal vascularization and stabilizes β-catenin (CTNNB1). It cooperates with TSPAN12 to independently activate FZD4, suggesting a Wnt-independent mechanism. Norrin Protein, Human is the recombinant human-derived Norrin protein, expressed by E. coli , with tag free. The total length of Norrin Protein, Human is 109 a.a., with molecular weight of ~13 kDa.

Norrin Protein, as a vital player in the canonical Wnt signaling pathway, activates this pathway by engaging the FZD4 and LRP5 coreceptor complex. Its significance lies in its central role in retinal vascularization, as it acts as a ligand for FZD4, resulting in the stabilization of beta-catenin (CTNNB1) and the activation of LEF/TCF-mediated transcriptional programs. Additionally, Norrin Protein collaborates with TSPAN12 to independently activate FZD4, suggesting the existence of a Wnt-independent signaling mechanism that also contributes to the accumulation of beta-catenin (CTNNB1). Furthermore, Norrin Protein may participate in a pathway that regulates neural cell differentiation and proliferation, and it potentially plays a role in neuroectodermal cell-cell interactions. It forms homodimers through disulfide linkages and is part of a complex consisting of TSPAN12, FZD4, LRP5/6, and norrin itself (NDP). Notably, Norrin Protein exhibits a high affinity for binding to FZD4 and interacts with LRP6, specifically with its Beta-propellers 1 and 2.

Measured by its binding ability in a functional ELISA. When Human Norrin is coated at 0.5 μg/mL (100 μL/well) can bind Human Frizzled­4. The ED₅₀ for this effect is 86.34 ng/mL.

Human

E. coli

Tag Free

Q00604 (K25-S133)

4693  [NCBI]

KTDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNS

Approximately 13 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 4 mM HCL, pH 2.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.