1. Recombinant Proteins
  2. Others
  3. NTAQ1 Protein, Human (GST)

NTAQ1 Protein is a monomeric globular protein with alpha-beta-alpha three-layer sandwich architecture. NTAQ1 converts N-terminal glutamine to glutamate by eliminating the amine group and plays an essential role in the N-end rule pathway for protein degradation. The active site and catalytic mechanism of NTAQ1 are similar to those of transglutaminases. NTAQ1 Protein, Human (GST) is the recombinant human-derived NTAQ1 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NTAQ1 Protein is a monomeric globular protein with alpha-beta-alpha three-layer sandwich architecture. NTAQ1 converts N-terminal glutamine to glutamate by eliminating the amine group and plays an essential role in the N-end rule pathway for protein degradation. The active site and catalytic mechanism of NTAQ1 are similar to those of transglutaminases. NTAQ1 Protein, Human (GST) is the recombinant human-derived NTAQ1 protein, expressed by E. coli , with N-GST labeled tag.

Background

Protein N-terminal glutamine amidohydrolase (NTAQ1) is a monomeric globular protein with alpha-beta-alpha three-layer sandwich architecture. The catalytic triad located in the active site, Cys-His-Asp, is highly conserved among Ntaq family and transglutaminases from diverse organisms. NTAQ1 converts N-terminal glutamine to glutamate by eliminating the amine group and plays an essential role in the N-end rule pathway for protein degradation. Conversion of the resulting N-terminal glutamine to glutamate renders the protein susceptible to arginylation, polyubiquitination and degradation as specified by the N-end rule. NTAQ1 does not act on substrates with internal or C-terminal glutamine and does not act on non-glutamine residues in any position. In addition, it does not deaminate acetylated N-terminal glutamine. The active site and catalytic mechanism of NTAQ1 are similar to those of transglutaminases[1][2].

Species

Human

Source

E. coli

Tag

N-GST

Accession

AAH08781.1 (M1-C205)

Gene ID

55093  [NCBI]

Molecular Construction
N-term
GST
NTAQ1 (M1-C205)
Accession # AAH08781.1
C-term
Synonyms
Protein N-terminal glutamine amidohydrolase; WDYHV1; Protein NH2-terminal glutamine deamidase; N-terminal Gln amidase; Nt(Q)-amidase; C8orf32; NTAQ1
AA Sequence

MEGNGPAAVHYQPASPPRDACVYSSCYCEENVWKLCEYIKNHDQYPLEECYAVFISNERKMIPIWKQQARPGDGPVIWDYHVVLLHVSSGGQSFIYDLDTVLPFPCLFDTYVEDAIKSDDDIHPQFRRKFRVICADSYLKNFASDRSHMKDSSGNWREPPPPYPCIETGDSKMNLNDFISMDPKVGWGAVYTLSEFTHRFGSKNC

Molecular Weight

45-50 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

NTAQ1 Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NTAQ1 Protein, Human (GST)
Cat. No.:
HY-P71174
Quantity:
MCE Japan Authorized Agent: