1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. OSM Protein, Mouse (HEK293)

OSM Protein, Mouse (HEK293) is a gp130 cytokine family member, shows homeostatic and proinflammatory activities and can modify extracellular matrix.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE OSM Protein, Mouse (HEK293)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

OSM Protein, Mouse (HEK293) is a gp130 cytokine family member, shows homeostatic and proinflammatory activities and can modify extracellular matrix.

Background

Oncostatin M is a gp130 cytokine family member, shows homeostatic and proinflammatory activities and can modify extracellular matrix[1].

Biological Activity

Measured in a cell proliferation assay using NIH/3T3 mouse embryonic fibroblasts cells. The ED50 this effect is ≤4.975 ng/mL, corresponding to a specific activity is > 2.0101×105 units/mg.

  • Measured in a cell proliferation assay using NIH/3T3 mouse embryonic fibroblasts cells. The ED50 for this effect is 4.975 ng/mL, corresponding to a specific activity is 2.0101×105 units/mg.
Species

Mouse

Source

HEK293

Tag

Tag Free

Accession

P53347 (A24-R206)

Gene ID
Molecular Construction
N-term
OSM (A24-R206)
Accession # P53347
C-term
Synonyms
rMuOSM; Oncostatin-M
AA Sequence

ANRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRVLYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGYHRFMGSVGRVFREWDDGSTRSRR

Molecular Weight

Approximately 33.25 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

OSM Protein, Mouse (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
OSM Protein, Mouse (HEK293)
Cat. No.:
HY-P7274
Quantity:
MCE Japan Authorized Agent: