OSM Protein, Mouse (HEK293)

OSM Protein, Mouse (HEK293) is a gp130 cytokine family member, shows homeostatic and proinflammatory activities and can modify extracellular matrix.

Oncostatin M is a gp130 cytokine family member, shows homeostatic and proinflammatory activities and can modify extracellular matrix^[1].

Measured in a cell proliferation assay using NIH/3T3 mouse embryonic fibroblasts cells. The ED₅₀ this effect is ≤4.975 ng/mL, corresponding to a specific activity is > 2.0101×10⁵ units/mg.

• 
  Measured in a cell proliferation assay using NIH/3T3 mouse embryonic fibroblasts cells. The ED₅₀ for this effect is 4.975 ng/mL, corresponding to a specific activity is 2.0101×10⁵ units/mg.

Mouse

HEK293

Tag Free

P53347 (A24-R206)

18413  [NCBI]

ANRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRVLYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGYHRFMGSVGRVFREWDDGSTRSRR

Approximately 33.25 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Richards CD, et al. Regulation of IL-33 by Oncostatin M in Mouse Lung Epithelial Cells. Mediators Inflamm. 2016;2016:9858374.  [Content Brief]