OV16 Protein, Onchocerca volvulus (GST)

The OV16 protein is a phosphatidylethanolamine-binding protein found in the subcutaneous tissue, stratum corneum, and uterus and has been shown to be involved in multiple physiological functions, possibly related to structural integrity and reproduction. It belongs to the phosphatidylethanolamine-binding protein family, suggesting a role in lipid processes or signaling. OV16 Protein, Onchocerca volvulus (GST) is the recombinant OV16 protein, expressed by HEK293 , with N-GST labeled tag. The total length of OV16 Protein, Onchocerca volvulus (GST) is 181 a.a., with molecular weight of ~45 kDa.

OV16 Protein, a member of the phosphatidylethanolamine-binding protein family, is localized in the hypodermis, cuticle, and uterus. This protein's distribution across these cellular structures suggests its involvement in diverse physiological functions, potentially related to structural integrity and reproductive processes. The designation within the phosphatidylethanolamine-binding protein family hints at its putative role in lipid-related processes or cellular signaling. The specific localization in the hypodermis and cuticle may imply functions related to structural support or protection, while its presence in the uterus suggests a potential role in reproductive biology or embryonic development. The broader implications of OV16 Protein within these cellular contexts underscore its significance in various aspects of cellular and organismal biology.

Others

HEK293

N-GST

P31729-1 (K17-D197)

/

KISAENANCKKCTPMLVDSAFKEHGIVPDVVSTAPTKLVNVSYNNLTVNLGNELTPTQVKNQPTKVSWDAEPGALYTLVMTDPDAPSRKNPVFREWHHWLIINISGQNVSSGTVLSDYIGSGPRKGTGLHRYVFLVYKQPGSITDTQHGGNRRNFKVMDFANKHHLGNPVAGNFFQAKHED

Approximately 45 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.