1. Recombinant Proteins
  2. CD Antigens Receptor Proteins Biotinylated Proteins
  3. Platelet CD Proteins Endothelial cell CD Proteins Cell Adhesion Molecules (CAMs)
  4. P-Selectin/CD62P Selectin
  5. P-Selectin/CD62P
  6. P-Selectin Protein, Human (Biotinylated, HEK293, His-Avi)

P-Selectin Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78201
SDS COA Handling Instructions Technical Support

P-selectin is a Ca(2+)-dependent receptor on myeloid cells that critically binds to sialic acid-Lewis X on neutrophils and monocytes, promoting the interaction between activated endothelial cells or platelets and leukocytes interaction. This binding primarily to SELPLG/PSGL1 and PODXL2 is critical for rapid rolling of leukocytes during early inflammation. P-Selectin Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived P-Selectin protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of P-Selectin Protein, Human (Biotinylated, HEK293, His-Avi) is 730 a.a., with molecular weight of 115-140 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

P-selectin is a Ca(2+)-dependent receptor on myeloid cells that critically binds to sialic acid-Lewis X on neutrophils and monocytes, promoting the interaction between activated endothelial cells or platelets and leukocytes interaction. This binding primarily to SELPLG/PSGL1 and PODXL2 is critical for rapid rolling of leukocytes during early inflammation. P-Selectin Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived P-Selectin protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of P-Selectin Protein, Human (Biotinylated, HEK293, His-Avi) is 730 a.a., with molecular weight of 115-140 kDa.

Background

P-selectin, a Ca(2+)-dependent receptor on myeloid cells, facilitates the binding to carbohydrates on neutrophils and monocytes, playing a crucial role in the interaction of activated endothelial cells or platelets with leukocytes. The ligand recognized by P-selectin is sialyl-Lewis X, and this interaction is pivotal for the rapid rolling of leukocytes over vascular surfaces during the initial stages of inflammation, accomplished through engagement with SELPLG. Additionally, P-selectin forms interactions with SNX17 and mediates adhesion and rolling of neutrophils through its association with SELPLG/PSGL1 and PODXL2. This interaction is contingent on the sialyl-Lewis X epitope of SELPLG and PODXL2, as well as the specific tyrosine sulfation on SELPLG.

Biological Activity

Measured by its binding ability in a functional ELISA. When immobilized Anti-P-selectin Antibody, hFc Tag at 0.5mg/ml (100μl/Well), can bind Biotinylated Human P-Selectin, His Tag and the EC50 is 0.13 μg/mL.

Species

Human

Source

HEK293

Tag

C-Avi;C-His

Accession

P16109 (W42-A771)

Gene ID
Molecular Construction
N-term
P-Selectin (W42-A771)
Accession # P16109
His-Avi
C-term
Synonyms
FLJ45155; GMP140; GRMP; PADGEM; PSEL; P-Selectin; SELP; CD62P; CD62; LECAM3
AA Sequence

WTYHYSTKAYSWNISRKYCQNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADNEPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDGYQVNGPSKLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGFALVGPEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCVHPLTAFAYGSSCKFECQPGYRVRGLDMLRCIDSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFMLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNEGLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCQFICDEGYSLSGPERLDCTRSGRWTDSPPMCEAIKCPELFAPEQGSLDCSDTRGEFNVGSTCHFSCDNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGVQCPALTTPGQGTMYCRHHPGTFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNLWGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEA

Molecular Weight

115-140 kDa

Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

P-Selectin Protein, Human (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
P-Selectin Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78201
Quantity:
MCE Japan Authorized Agent: