1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Cyclin-Dependent Kinase Inhibitor Proteins
  4. Cyclin-Dependent Kinase 4 Inhibitor D
  5. p19INK4d Protein, Human (His)

The p19INK4d protein, a potent inhibitor, strongly interacts with CDK4 and CDK6, effectively impeding their activity. Specifically interacting with CDK6, p19INK4d reinforces its role as a regulator of cyclin-dependent kinase activity. This crucial role in cell cycle regulation involves restraining CDK4 and CDK6 functions, contributing to the modulation of key cellular processes. p19INK4d Protein, Human (GST) is the recombinant human-derived p19INK4d protein, expressed by E. coli , with N-GST labeled tag. The total length of p19INK4d Protein, Human (GST) is 166 a.a., with molecular weight of ~46 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The p19INK4d protein, a potent inhibitor, strongly interacts with CDK4 and CDK6, effectively impeding their activity. Specifically interacting with CDK6, p19INK4d reinforces its role as a regulator of cyclin-dependent kinase activity. This crucial role in cell cycle regulation involves restraining CDK4 and CDK6 functions, contributing to the modulation of key cellular processes. p19INK4d Protein, Human (GST) is the recombinant human-derived p19INK4d protein, expressed by E. coli , with N-GST labeled tag. The total length of p19INK4d Protein, Human (GST) is 166 a.a., with molecular weight of ~46 kDa.

Background

The p19INK4d protein serves as a potent inhibitor by interacting strongly with CDK4 and CDK6, effectively impeding their activity. Additionally, p19INK4d specifically interacts with CDK6, reinforcing its role as a regulator of cyclin-dependent kinase activity. Through these interactions, p19INK4d plays a crucial role in cell cycle regulation by restraining the function of CDK4 and CDK6, contributing to the modulation of key cellular processes.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant human p19INK4d at 10 μg/mL (100 μL/well) can bind biotinylated human CDK4. The ED50 for this effect is 0.9121 μg/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant human p19INK4d at 10 μg/ml (100 μL/well) can bind biotinylated human CDK4. The ED50 for this effect is 0.9121 μg/mL.
Species

Human

Source

E. coli

Tag

N-6*His

Accession

P55273 (D10-L166)

Gene ID
Molecular Construction
N-term
GST
p19INK4d (M1-L166)
Accession # P55273
C-term
Synonyms
Cyclin-dependent kinase 4 inhibitor D; p19-INK4d; CDKN2D
AA Sequence

DRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL

Molecular Weight

Approximately 19 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
p19INK4d Protein, Human (His)
Cat. No.:
HY-P74659
Quantity:
MCE Japan Authorized Agent: