PD-1 Protein, Mouse (HEK293, Fc)

The PD-1 protein is expressed on antigen-activated T cells and can induce and maintain immune tolerance to itself.PD-1 binds to CD274/PDCD1L1 and CD273/PDCD1LG2, transmits inhibitory signals, inhibits T cell activation and regulates immune responses.PD-1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived PD-1 protein, expressed by HEK293 , with C-hFc labeled tag.

PD-1, an inhibitory receptor expressed on antigen-activated T-cells, plays a crucial role in the induction and maintenance of immune tolerance to self. Upon binding to ligands like CD274/PDCD1L1 and CD273/PDCD1LG2, PD-1 delivers inhibitory signals, suppressing T-cell activation and contributing to the regulation of immune responses. Following T-cell receptor engagement, PD-1 associates with CD3-TCR in the immunological synapse, directly inhibiting T-cell activation. The inhibitory effects involve the recruitment of PTPN11/SHP-2, which dephosphorylates key signaling molecules proximal to the TCR. Exploited by tumors, the PD-1-mediated inhibitory pathway serves to attenuate anti-tumor immunity and promote tumor survival. PD-1 exists as a monomer and interacts with CD274/PDCD1L1 and CD273/PDCD1LG2, while interaction with FBXO38 leads to ubiquitination and proteasomal degradation.

1. Determined by its ability to prevent plate adhesion of PHA-stimulated Jurkat cells in the presence of 625 ng/mL of bound hPD-L1. The ED50 this effect is 1.974 μg/mL, corresponding to a specific activity is 5.07×10^2 units/mg.
2. Immobilized Recombinant Mouse PD-1 at 1 μg/ml (100 μl/well) can bind Recombinant Mouse PD-L1. The ED₅₀ for this effect is 0.6932 μg/mL.

• 
  Determined by its ability to prevent plate adhesion of PHA-stimulated Jurkat cells in the presence of 625ng/mL of bound hPD-L1.  The ED₅₀ for this effect is 1.974 μg/mL, corresponding to a specific activity is 5.07×10² units/mg.

Mouse

HEK293

C-hFc

Q02242 (L25-Q167)

18566  [NCBI]

LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ

Approximately 61.66 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.