1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. PDGFs & PDGFRs
  4. PDGF
  5. PDGF-D
  6. PDGF-DD Protein, Human (CHO)

PDGF-DD Protein, Human (CHO)

Cat. No.: HY-P7280
COA Handling Instructions

PDGF-DD Protein, Human (CHO) is a member of the PDGF family, specifically binds to and activates its cognate receptor PDGFR-β, and participates in regulating cancer proliferation, transformation, and invasion through activating multiple downstream oncogenic pathways, resulting in tumor development and progression.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $150 In-stock
50 μg $450 In-stock
100 μg $833 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE PDGF-DD Protein, Human (CHO)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

PDGF-DD Protein, Human (CHO) is a member of the PDGF family, specifically binds to and activates its cognate receptor PDGFR-β, and participates in regulating cancer proliferation, transformation, and invasion through activating multiple downstream oncogenic pathways, resulting in tumor development and progression.

Background

PDGF-DD is a member of the PDGF family, specifically binds to and activates its cognate receptor PDGFR-β, and participates in regulating cancer proliferation, transformation, and invasion through activating multiple downstream oncogenic pathways, resulting in tumor development and progression[1].

Biological Activity

ED50 < 5.0 μg/mL, measured in a cell proliferation assay using 3T3 cells.

Species

Human

Source

CHO

Tag

Tag Free

Accession

Q9GZP0-1 (S250-R370)

Gene ID
Molecular Construction
N-term
PDGF-DD (S250-R370)
Accession # Q9GZP0-1
C-term
Synonyms
rHuPDGF-DD; Platelet-derived growth factor D; SCDGFB
AA Sequence

SYHDRKSKVDLDRLNDDAKRYSCTPRNYSVNIREELKLANVVFFPRCLLVQRCGGNCGCGTVNWRSCTCNSGKTVKKYHEVLQFEPGHIKRRGRAKTMALVDIQLDHHERCDCICSSRPPR

Molecular Weight

19-21 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

PDGF-DD Protein, Human (CHO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDGF-DD Protein, Human (CHO)
Cat. No.:
HY-P7280
Quantity:
MCE Japan Authorized Agent: