Peptidyl-prolyl cis-trans isomerase A/CYPA Protein, Human

CYPA protein, a peptidyl prolyl cis-trans isomerase, has proinflammatory activity by stimulating activation of NF-kappa-B and ERK, JNK, and p38 MAP kinases. It may act as a mediator between the human SARS coronavirus nucleoprotein and BSG/CD147 during the virus' invasion of host cells. Peptidyl-prolyl cis-trans isomerase A/CYPA Protein, Human is the recombinant human-derived Peptidyl-prolyl cis-trans isomerase A/CYPA protein, expressed by E. coli , with tag free.

Peptidyl-prolyl cis-trans isomerase A (CYP A) catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. This enzyme plays a multifaceted role, exerting a strong chemotactic effect on leukocytes through the activation of its membrane receptor BSG/CD147, initiating a signaling cascade culminating in MAPK/ERK activation. Additionally, CYP A activates endothelial cells (ECs) in a pro-inflammatory manner, inducing NF-kappa-B and MAP-kinase signaling, and upregulating adhesion molecules. It induces apoptosis in ECs, promoting FOXO1-dependent expression of CCL2 and BCL2L11. In response to oxidative stress, CYP A initiates proapoptotic and antiapoptotic signaling in ECs. It negatively regulates MAP3K5/ASK1 kinase activity and is necessary for the assembly of TARDBP in heterogeneous nuclear ribonucleoprotein complexes, regulating TARDBP binding to RNA. CYP A also plays a crucial role in platelet activation and aggregation, regulates calcium mobilization, and facilitates integrin ITGA2B:ITGB3 bidirectional signaling. Moreover, it inhibits replication of influenza A virus and may act as a mediator between the SARS coronavirus nucleoprotein and BSG/CD147 during virus invasion of host cells.

Measured by its ability to inhibit calcineurin phosphatase activity in the presence of Cyclosporin A. The IC₅₀ for inhibition of calcineurin activity is 234.46 nM, as measured under the described conditions.

Human

E. coli

Tag Free

P62937-1 (M1-E165)

5478  [NCBI]

MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

16-18 kDa

Greater than 95% as determined by reducing SDS-PAGE

Solution

Supplied as a 0.2 μm filtered solution of PBS, 10% glycerol, pH 7.4.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.